Surfactant Protein A1 anticorps (AA 206-237)

N° du produit ABIN2744324

L’anticorps Lapin Polyclonal anti-Surfactant Protein A1 a été validé pour WB, IHC et IHC (p). Il convient pour détecter Surfactant Protein A1 dans des échantillons de Humain, Rat, Souris, Chimpanzé et Orang-Utan.

Aperçu rapide pour Surfactant Protein A1 anticorps (AA 206-237) (ABIN2744324)

Antigène: Surfactant Protein A1 (SFTPA1)

Reactivité: Humain, Rat, Souris, Chimpanzé, Orang-Utan

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Surfactant Protein A1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-Surfactant Protein A1 anticorps

Épitope: AA 206-237

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human SFTPA1/2(206-237aa VNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRN), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur Surfactant Protein A1

Antigène: Surfactant Protein A1 (SFTPA1)

Autre désignation: SFTPA1 + SFTPA2

Sujet: Name/Gene ID: SFTPA1

Synonyms: SFTPA1, Alveolar proteinosis protein, COLEC4, Collectin-4, PSP-A, PSPA, SFTP1, SFTPA, SFTPA1B, SPA1, SP-A, SP-A1, SPA, Surfactant Protein A, Surfactant protein A1, Surfactant protein A1B

ID gène: 653509