SMN1 anticorps (AA 22-52)

N° du produit ABIN2744443

Cet anticorps Lapin Polyclonal détecte spécifiquement SMN1 dans WB, IHC et IHC (p). Il présente une réactivité envers Humain, Souris, Rat, Singe, Chien, Lapin et Chimpanzé.

Aperçu rapide pour SMN1 anticorps (AA 22-52) (ABIN2744443)

Antigène: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Reactivité: Humain, Souris, Rat, Singe, Chien, Lapin, Chimpanzé

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMN1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-SMN1 anticorps

Épitope: AA 22-52

Specificité: Expressed in a wide variety of tissues. Expressed at high levels in brain, kidney and liver, moderate levels in skeletal and cardiac muscle, and low levels in fibroblasts and lymphocytes. Also seen at high levels in spinal cord. Present in osteoclasts and mononuclear cells (at protein level). .

Purification: Immunogen affinity purified

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2(22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: Optimal working dilution should be determined by the investigator.

Commentaires:

Target Species of Antibody: Human

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Distilled water

Concentration: Lot specific

Buffer: Lyophilized from 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg sodium phosphate, 0.05 mg sodium azide

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: avoid freeze thaw cycles

Stock: 4 °C,-20 °C

Stockage commentaire: At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time.Avoid freeze-thaw cycles.

Détails sur SMN1

Antigène: SMN1 (Survival of Motor Neuron 1, Telomeric (SMN1))

Autre désignation: SMN1

Sujet: Name/Gene ID: SMN1

Synonyms: SMN1, BCD541, Component of gems 1, Gemin-1, SMA2, SMA4, SMA@, SMA1, SMNC, SMNT, T-BCD541, SMN, Survival motor neuron protein, Gemin 1, GEMIN1, SMA, SMA3

ID gène: 6606

Pathways: Ribonucleoprotein Complex Subunit Organization