ZNF566 anticorps (Middle Region)

N° du produit ABIN2787529

Cet anticorps Lapin Polyclonal détecte spécifiquement ZNF566 dans WB. Il présente une réactivité envers Humain, Boeuf (Vache), Cheval, Rat, Chien, Porc, Lapin, Cobaye, Souris et Poisson zèbre (Danio rerio).

Aperçu rapide pour ZNF566 anticorps (Middle Region) (ABIN2787529)

Antigène: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Reactivité: Humain, Boeuf (Vache), Cheval, Rat, Chien, Porc, Lapin, Cobaye, Souris, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF566 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ZNF566 anticorps

Épitope: Middle Region

Séquence: YECKECGKAF SSGSNFTQHQ RIHTGEKPYE CKECGNAFSQ SSQLIKHQRI

Homologie: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%

Attributs du produit: This is a rabbit polyclonal antibody against Zfp566. It was validated on Western Blot.

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Information d'application

Indications d'application: Optimal working dilutions should be determined experimentally by the investigator.

Commentaires:

Antigen size: 386 AA

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freeze-thaw cycles.

Stock: -20 °C

Stockage commentaire: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Détails sur ZNF566

Antigène: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Autre désignation: Zfp566

Sujet: The function of this protein remains unknown.
Alias Symbols: RGD1563239
Protein Size: 386

Poids moléculaire: 45 kDa

ID gène: 502316

NCBI Accession: NM_001134726, NP_001128198

UniProt: B2RZ94