ZNF566 anticorps (Middle Region)

N° du produit ABIN2787529

Détail du produit anti-ZNF566 anticorps

Antigène: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Épitope: Middle Region

Reactivité: Humain, Boeuf (Vache), Cheval, Rat, Chien, Porc, Lapin, Cobaye, Souris, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZNF566 est non-conjugé

Application: Western Blotting (WB)

Séquence: YECKECGKAF SSGSNFTQHQ RIHTGEKPYE CKECGNAFSQ SSQLIKHQRI

Homologie: Cow: 93%, Dog: 93%, Guinea Pig: 86%, Horse: 100%, Human: 100%, Mouse: 100%, Pig: 93%, Rabbit: 93%, Rat: 100%, Zebrafish: 93%

Attributs du produit: This is a rabbit polyclonal antibody against Zfp566. It was validated on Western Blot.

Purification: Affinity Purified

Immunogène: The immunogen is a synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI

Information d'application

Indications d'application: Optimal working dilutions should be determined experimentally by the investigator.

Commentaires:

Antigen size: 386 AA

Restrictions: For Research Use only

Stockage

Format: Liquid

Concentration: Lot specific

Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freeze-thaw cycles.

Stock: -20 °C

Stockage commentaire: For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

Détails sur ZNF566

Antigène: ZNF566 (Zinc Finger Protein 566 (ZNF566))

Autre désignation: Zfp566 (ZNF566 Produits)

Synonymes: anticorps ZNF420, anticorps RGD1563239, anticorps zinc finger protein 566, anticorps ZNF566, anticorps Zfp566

Sujet: The function of this protein remains unknown.
Alias Symbols: RGD1563239
Protein Size: 386

Poids moléculaire: 45 kDa

ID gène: 502316

NCBI Accession: NM_001134726, NP_001128198

UniProt: B2RZ94