ACTH anticorps (Middle Region)

N° du produit ABIN3029882

L’anticorps anti-ACTH Polyclonal Lapin est utilisé pour la détection de ACTH dans des échantillons de Humain, Rat et Souris. Il a été validé pour IHC (p).

Aperçu rapide pour ACTH anticorps (Middle Region) (ABIN3029882)

Antigène: ACTH (Adrenocorticotropic hormone (ACTH))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACTH est non-conjugé

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-ACTH anticorps

Épitope: Middle Region

Purification: Antigen affinity

Immunogène: An amino acid sequence from the middle region of human Adrenocorticotropic hormone (SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF) was used as the immunogen for this ACTH antibody.

Isotype: IgG

Information d'application

Indications d'application: The stated application concentrations are suggested starting amounts. Titration of the ACTH antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the ACTH antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur ACTH

Antigène: ACTH (Adrenocorticotropic hormone (ACTH))

Autre désignation: ACTH

Classe de substances: Hormone

Sujet: Adrenocorticotropic hormone (ACTH), also known as Corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.

ID gène: 5443

Pathways: Metabolism of Steroid Hormones and Vitamin D, Peptide Hormone Metabolism, Hormone Activity