Unc5c anticorps (C-Term)
-
- Antigène Voir toutes Unc5c Anticorps
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
-
Épitope
- AA 894-930, C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Unc5c est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Netrin receptor UNC5C(UNC5C) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- DLWEAQNFPD GNLSMLAAVL EEMGRHETVV SLAAEGQ
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Netrin receptor UNC5C(UNC5C) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: unc-5 netrin receptor C
Protein Name: Netrin receptor UNC5C - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human UNC5C (894-930aa DLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQ), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product Unc5c Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- Unc5c (Unc-5 Homolog C (C. Elegans) (Unc5c))
- Autre désignation
- UNC5C (Unc5c Produits)
- Synonymes
- anticorps UNC5C, anticorps UNC5H3, anticorps 6030473H24, anticorps AI047720, anticorps B130051O18Rik, anticorps Unc5h3, anticorps rcm, anticorps wu:fb03d07, anticorps unc-5 netrin receptor C, anticorps UNC5C, anticorps Unc5c, anticorps unc5c
- Sujet
-
Netrin receptor UNC5C is a protein that in humans is encoded by the UNC5C gene. This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediates the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Synonyms: homolog of C. elegans transmembrane receptor Unc5 antibody|Netrin receptor UNC5C antibody|Protein unc 5 homolog C antibody|Protein unc-5 homolog 3 antibody|Protein unc-5 homolog C antibody|Unc 5 homolog 3 antibody|Unc 5 homolog C antibody|Unc5 (C.elegans homolog) c antibody|Unc5c antibody|UNC5C_HUMAN antibody|UNC5H3 antibody - ID gène
- 8633
- UniProt
- O95185
-