MGST1 anticorps (N-Term)

N° du produit ABIN3042364

Détail du produit anti-MGST1 anticorps

Antigène: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Épitope: AA 42-75, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MGST1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: KVFANPEDCV AFGKGENAKK YLRTDDRVER VRRA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: microsomal glutathione S-transferase 1
Protein Name: Microsomal glutathione S-transferase 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human MGST1 (42-75aa KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur MGST1

Antigène: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Autre désignation: MGST1 (MGST1 Produits)

Synonymes: anticorps gst12, anticorps mgst, anticorps mgst-i, anticorps zgc:101898, anticorps MGST1, anticorps GST12, anticorps MGST, anticorps MGST-I, anticorps 1500002K10Rik, anticorps Gst, anticorps microsomal glutathione S-transferase 1 L homeolog, anticorps microsomal glutathione S-transferase 1.1, anticorps microsomal glutathione S-transferase 1 pseudogene, anticorps microsomal glutathione S-transferase 1, anticorps mgst1.L, anticorps mgst1.1, anticorps LOC473380, anticorps MGST1, anticorps mgst1, anticorps CpipJ_CPIJ015233, anticorps CpipJ_CPIJ018241, anticorps Mgst1

Sujet: Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.

Synonyms: MGST1 antibody|Glutathione S transferase 12 antibody|GST12 antibody|MGST 1 antibody|MGST antibody|MGST1 antibody|MGST1_HUMAN antibody| Microsomal glutathione S-transferase 1 antibody|Microsomal GST 1 antibody|Microsomal GST-1 antibody|Microsomal GST-I antibody

ID gène: 4257

UniProt: P10620