FMO2 anticorps (N-Term)
-
- Antigène Voir toutes FMO2 Anticorps
- FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))
-
Épitope
- AA 78-115, N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FMO2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 2(FMO2) detection. Tested with WB in Human.
- Séquence
- FPNFLHNSKL LEYFRIFAKK FDLLKYIQFQ TTVLSVRK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Dimethylaniline monooxygenase [N-oxide-forming] 2(FMO2) detection. Tested with WB in Human.
Gene Name: flavin containing monooxygenase 2
Protein Name: Dimethylaniline monooxygenase [N-oxide-forming] 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human FMO2 (78-115aa FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK), different from the related mouse and rat sequences by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product FMO2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- FMO2 (Flavin Containing Monooxygenase 2 (Non-Functional) (FMO2))
- Autre désignation
- FMO2 (FMO2 Produits)
- Sujet
-
Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene. This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.
Synonyms: 2310008D08Rik antibody|2310042I22Rik antibody|AW107733 antibody|Dimethylaniline monooxygenase [N oxide forming] 2 antibody| Dimethylaniline monooxygenase [N-oxide-forming] 2 antibody|Dimethylaniline oxidase 2 antibody|Flavin containing monooxygenase 2 (non functional) antibody|Flavin containing monooxygenase 2 antibody|FLJ40826 antibody|FMO 1B1 antibody|FMO 2 antibody|FMO antibody|FMO pulmonary antibody|FMO1B1 antibody|FMO2 antibody|FMO2_HUMAN antibody|MGC28212 antibody|OTTMUSP00000028686 antibody|OTTMUSP00000028687 antibody|Pulmonary flavin containing monooxygenase 2 antibody|Pulmonary flavin-containing monooxygenase 2 antibody - ID gène
- 2327
- UniProt
- Q99518
-