FMR1 anticorps (N-Term)

N° du produit ABIN3042398

Détail du produit anti-FMR1 anticorps

Antigène: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Épitope: AA 164-200, N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FMR1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Synaptic functional regulator FMR1(FMR1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: ENYQLVILSI NEVTSKRAHM LIDMHFRSLR TKLSLIM

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Synaptic functional regulator FMR1(FMR1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: fragile X mental retardation 1
Protein Name: Synaptic functional regulator FMR1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human FMRP (164-200aa ENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIM), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur FMR1

Antigène: FMR1 (Fragile X Mental Retardation 1 (FMR1))

Autre désignation: FMR1 (FMR1 Produits)

Synonymes: anticorps AT24755, anticorps BcDNA:GM08679, anticorps CG6203, anticorps Dmel\\CG6203, anticorps EP(3)3517, anticorps FMR, anticorps FMR1, anticorps FMRP, anticorps FMRp, anticorps FXR, anticorps Fmrp, anticorps cg6203, anticorps dFMR, anticorps dFMR1, anticorps dFMRP, anticorps dFXR, anticorps dFXR1, anticorps dFXRP, anticorps dFmr1, anticorps dFmrp, anticorps dfmr, anticorps dfmr1, anticorps dfxr, anticorps dfxr1, anticorps dmfr1, anticorps fmr, anticorps fmr1, anticorps FRAXA, anticorps POF, anticorps POF1, anticorps zFMR1, anticorps Fmr-1, anticorps CG6203 gene product from transcript CG6203-RC, anticorps fragile X mental retardation 1, anticorps fragile X mental retardation syndrome 1, anticorps Fmr1, anticorps FMR1, anticorps fmr1

Sujet: FMR1 (fragile X mental retardation 1) is a human gene that codes for a protein called fragile X mentalretardation protein, or FMRP. This protein, most commonly found in the brain, is essential for normal cognitive development and female reproductive function. Mutations of this gene can lead to fragile X syndrome, mental retardation, premature ovarian failure, autism, Parkinson's disease, developmental delays and other cognitive deficits. The protein encoded by this gene binds RNA and is associated with polysomes. Additionally, the encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. Expansion of the trinucleotide repeat may also cause one form of premature ovarian failure (POF1). Multiple alternatively spliced transcript variants that encode different protein isoforms and which are located in different cellular locations have been described for this gene.

Synonyms: FMR 1 antibody|Fmr1 antibody|Fmr1 gene antibody|FMR1_HUMAN antibody|FMRP antibody|Fragile X mental retardation 1 antibody|Fragile X mental retardation 1 protein antibody|Fragile X mental retardation protein 1 antibody|FRAXA antibody|MGC87458 antibody|POF antibody| POF1 antibody|Protein FMR-1 antibody|Protein FMR1 antibody

ID gène: 2332

UniProt: Q06787

Pathways: Regulation of Muscle Cell Differentiation, Skeletal Muscle Fiber Development