HDAC6 anticorps (N-Term)

N° du produit ABIN3042440

Détail du produit anti-HDAC6 anticorps

Antigène: HDAC6 (Histone Deacetylase 6 (HDAC6))

Épitope: AA 137-169, N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HDAC6 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Histone deacetylase 6(HDAC6) detection. Tested with WB in Human,Rat.

Séquence: EKEELMLVHS LEYIDLMETT QYMNEGELRV LAD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Histone deacetylase 6(HDAC6) detection. Tested with WB in Human,Rat.
Gene Name: histone deacetylase 6
Protein Name: Histone deacetylase 6

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human HDAC6 (137-169aa EKEELMLVHSLEYIDLMETTQYMNEGELRVLAD), different from the related mouse sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HDAC6

Antigène: HDAC6 (Histone Deacetylase 6 (HDAC6))

Autre désignation: HDAC6 (HDAC6 Produits)

Synonymes: anticorps HD6, anticorps Hd6, anticorps Hdac5, anticorps Sfc6, anticorps mHDA2, anticorps CG6170, anticorps DHDAC2, anticorps DmHDAC2, anticorps Dmel\\CG6170, anticorps HDAC, anticorps HDAC2, anticorps dHDAC2, anticorps dHDAC6, anticorps dmHDA404, anticorps hdac6, anticorps MGC53140, anticorps wu:fc31d02, anticorps dsim_GLEANR_17355, anticorps DsimGD17207, anticorps GD17207, anticorps HDAC6, anticorps ATHDA6, anticorps AXE1, anticorps HISTONE DEACETYLASE 6, anticorps MDC12.7, anticorps MDC12_7, anticorps RNA-MEDIATED TRANSCRIPTIONAL SILENCING 1, anticorps RPD3B, anticorps RTS1, anticorps SIL1, anticorps histone deacetylase 6, anticorps histone deacetylase 6, anticorps Histone deacetylase 6, anticorps histone deacetylase 6 L homeolog, anticorps GD17207 gene product from transcript GD17207-RB, anticorps Histone DeAcetylase, anticorps HDAC6, anticorps Hdac6, anticorps hdac6.L, anticorps hdac6, anticorps Dsim\HDAC6, anticorps PTRG_03035, anticorps HDA6, anticorps hda-6

Sujet: HDAC6, also called KIAA0901, is a member belongs to class II of the histone deacetylase/acuc/apha family of proteins that is an enzyme that in humans is encoded by the HDAC6 gene. The HDAC6 gene is mapped to chromosome Xp11.23. HDAC6 contains an internal duplication of two catalytic domains which appear to function independently of each other. The protein possesses histone deacetylase activity and represses transcription. HDAC6 functions as a tubulin deacetylase. And it is localized exclusively in the cytoplasm, where it associates with microtubules and localizes with the microtubule motor complex. HDAC6 could bind both polyubiquitinated misfolded proteins and dynein motors, thereby recruiting misfolded protein cargo to dynein motors for transport to aggresomes. Furthermore, expression of HDAC6 was sufficient to rescue degeneration associated with UPS dysfunction in vivo in an autophagy-dependent manner. HDAC6 is a central component of the stress response that regulates SG formation and potentially contributes to control of RNA metabolism and translation.

Synonyms: FLJ16239 antibody|HD 6 antibody|HD6 antibody|HDAC 6 antibody|HDAC6 antibody|HDAC6_HUMAN antibody|Histone deacetylase 6 (HD6) antibody| Histone deacetylase 6 antibody|JM 21 antibody|JM21 antibody|KIAA0901 antibody|OTTHUMP00000032398 antibody|OTTHUMP00000197663 antibody

ID gène: 10013

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling