HNF1B anticorps (C-Term)

N° du produit ABIN3042452

Détail du produit anti-HNF1B anticorps

Antigène: HNF1B (HNF1 Homeobox B (HNF1B))

Épitope: AA 496-525, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HNF1B est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human,Rat.

Séquence: AQQPFMAAVT QLQNSHMYAH KQEPPQYSHT

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human,Rat.
Gene Name: HNF1 homeobox B
Protein Name: Hepatocyte nuclear factor 1-beta

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur HNF1B

Antigène: HNF1B (HNF1 Homeobox B (HNF1B))

Autre désignation: HNF1B (HNF1B Produits)

Synonymes: anticorps FJHN, anticorps HNF-1B, anticorps HNF1beta, anticorps HNF2, anticorps HPC11, anticorps LF-B3, anticorps LFB3, anticorps MODY5, anticorps TCF-2, anticorps TCF2, anticorps VHNF1, anticorps HNF-1b, anticorps HNF1B, anticorps AI385728, anticorps AI987804, anticorps HNF-1Beta, anticorps Hnf1beta, anticorps Tcf-2, anticorps Tcf2, anticorps vHNF1, anticorps vHNF-1, anticorps chunp6877, anticorps hnf1b, anticorps mst, anticorps tcf2, anticorps vhnf1, anticorps lfb3, anticorps hnf-1beta, anticorps hnf1-beta, anticorps hnf1beta, anticorps HNF1g, anticorps wu:fc23f06, anticorps HNF1 homeobox B, anticorps HNF1 homeobox Ba, anticorps HNF1 homeobox B S homeolog, anticorps HNF1 homeobox B L homeolog, anticorps HNF1 homeobox Bb, anticorps HNF1B, anticorps Hnf1b, anticorps hnf1ba, anticorps hnf1b.S, anticorps hnf1b.L, anticorps hnf1bb

Sujet: HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).

Synonyms: FJHN antibody|Hepatocyte nuclear factor 1 beta antibody|Hepatocyte nuclear factor 1-beta antibody|HNF 1B antibody|HNF 2 antibody|HNF-1-beta antibody|HNF-1B antibody|HNF1 beta antibody|HNF1 homeobox B antibody|HNF1B antibody|HNF1beta antibody|HNF2 antibody| Homeoprotein LF B3 antibody|Homeoprotein LFB3 antibody|HPC11 antibody|LF B3 antibody|LFB3 antibody|MODY 5 antibody|MODY5 antibody|TCF 2 antibody|TCF 2 protein antibody|TCF-2 antibody|TCF2 antibody|TCF2 protein antibody|Transcription factor 2 antibody|Transcription factor 2 hepatic antibody|Variant hepatic nuclear factor 1 antibody|Variant hepatic nuclear factor antibody|VHNF 1 antibody|vHNF1 antibody

ID gène: 6928

UniProt: P35680

Pathways: Hormone Transport, Stem Cell Maintenance, Tube Formation