HPSE anticorps (Middle Region)

N° du produit ABIN3042457

Détail du produit anti-HPSE anticorps

Antigène: HPSE (Heparanase (HPSE))

Épitope: AA 301-331, Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HPSE est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human,Rat.

Séquence: NGRTATKEDF LNPDVLDIFI SSVQKVFQVV E

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Heparanase(HPSE) detection. Tested with WB in Human,Rat.
Gene Name: heparanase
Protein Name: Heparanase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Heparanase 1 (301-331aa NGRTATKEDFLNPDVLDIFISSVQKVFQVVE), different from the related mouse and rat sequences by eight amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat, The detection limit for Heparanase 1 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-HPSE (ABIN3042457)

Tang, Piao, Zhao, Mu, Li, Ma, Song, Wang, Zhao, Zhang: "Expression and correlation of matrix metalloproteinase-9 and heparanase in patients with breast cancer." dans: Medical oncology (Northwood, London, England), Vol. 31, Issue 7, pp. 26, (2014) (PubMed).

Huining, Yi, Dihong, Yifeng, Man, Ting, Jingting: "Inhibition of choriocarcinoma by Fe3O4-dextran-anti-β-human chorionic gonadotropin nanoparticles containing antisense oligodeoxynucleotide of heparanase." dans: International journal of nanomedicine, Vol. 8, pp. 4371-8, (2014) (PubMed).

Tang, Zhang, Zhao, Wang, Lu, Song, Zhao, Kang, Wang, Xu, Tian: "The expression and clinical significance of microRNA-1258 and heparanase in human breast cancer." dans: Clinical biochemistry, Vol. 46, Issue 10-11, pp. 926-32, (2013) (PubMed).

Détails sur HPSE

Antigène: HPSE (Heparanase (HPSE))

Autre désignation: HPSE (HPSE Produits)

Synonymes: anticorps im:7144134, anticorps hpa, anticorps hpa1, anticorps hpr1, anticorps hpse1, anticorps hse1, anticorps HPSE, anticorps HPA, anticorps HPA1, anticorps HPR1, anticorps HPSE1, anticorps HSE1, anticorps Hpa, anticorps Hpr1, anticorps Hep, anticorps heparanase, anticorps HPSE, anticorps hpse, anticorps Hpse

Sujet: Heparanase, also known as HPSE, is an enzyme that acts both at the cell-surface and within the extracellular matrix to degrade polymeric heparan sulfate molecules into shorter chain length oligosaccharides. Heparanase is an endo-beta-D-glucuronidase capable of cleaving heparan sulfate and has been implicated in inflammation and tumor angiogenesis and metastasis. The successful penetration of the endothelial cell layer that lines the interior surface of blood vessels is an important process in the formation of blood borne tumour metastases. Heparan sulfate proteoglycans are major constituents of this layer and it has been shown that increased metastatic potential corresponds with increased heparanase activity for a number of cell lines.

Synonyms: Endo glucoronidase antibody|Endo-glucoronidase antibody|HEP antibody|Heparanase 50 kDa subunit antibody|Heparanase antibody|Heparanase-1 antibody|Heparanase1 antibody|Hpa 1 antibody|HPA antibody|Hpa1 antibody|HPR 1 antibody|HPR1 antibody|HPSE 1 antibody|HPSE antibody|HPSE_HUMAN antibody|HPSE1 antibody|HSE 1 antibody|HSE1 antibody

ID gène: 10855

UniProt: Q9Y251

Pathways: Glycosaminoglycan Metabolic Process