SP5 anticorps (Middle Region)

N° du produit ABIN3042490

Détail du produit anti-SP5 anticorps

Antigène: SP5 (Sp5 Transcription Factor (SP5))

Épitope: AA 246-275, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SP5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.

Séquence: DFAQYQSQIA ALLQTKAPLA ATARRCRRCR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Transcription factor Sp5(SP5) detection. Tested with WB, IHC-P in Human.
Gene Name: Sp5 transcription factor
Protein Name: Transcription factor Sp5

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Sp5 is approximately 0.1 ng/lane under reducing conditions.
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SP5

Antigène: SP5 (Sp5 Transcription Factor (SP5))

Autre désignation: SP5 (SP5 Produits)

Synonymes: anticorps bts1, anticorps fc39b01, anticorps wu:fc39b01, anticorps Bricd6, anticorps SP-C, anticorps SP5, anticorps SPC, anticorps Sftp-2, anticorps Sftp2, anticorps pro-SpC, anticorps Sp5 transcription factor, anticorps Sp5 transcription factor a, anticorps surfactant associated protein C, anticorps trans-acting transcription factor 5, anticorps Sp5, anticorps sp5a, anticorps SP5, anticorps CpipJ_CPIJ003609, anticorps Sftpc

Sujet: Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.

Synonyms: Transcription factor Sp5 antibody

ID gène: 389058