Otoferlin anticorps (C-Term)

N° du produit ABIN3042499

Détail du produit anti-Otoferlin anticorps

Antigène: Otoferlin (OTOF)

Épitope: AA 1831-1863, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Otoferlin est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: QIWDADHFSA DDFLGAIELD LNRFPRGAKT AKQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Otoferlin(OTOF) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: otoferlin
Protein Name: Otoferlin

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Otoferlin (1831-1863aa QIWDADHFSADDFLGAIELDLNRFPRGAKTAKQ), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Otoferlin

Antigène: Otoferlin (OTOF)

Autre désignation: OTOF (OTOF Produits)

Synonymes: anticorps OTOF, anticorps Otof, anticorps AUNB1, anticorps DFNB6, anticorps DFNB9, anticorps FER1L2, anticorps NSRD9, anticorps fj34b10, anticorps si:dkey-181f18.3, anticorps wu:fj34b10, anticorps otoferlin, anticorps putative otoferlin, anticorps otoferlin a, anticorps OTOF, anticorps LOC5565414, anticorps CpipJ_CPIJ002471, anticorps CpipJ_CPIJ010863, anticorps Smp_163750, anticorps otof, anticorps Otof, anticorps otofa

Sujet: Otoferlin is a protein that in humans is encoded by the OTOF gene. Mutations in this gene are a cause of neurosensory nonsyndromic recessive deafness, DFNB9. The short form of the encoded protein has three C2 domains, a single carboxy-terminal transmembrane domain found also in the C. elegans spermatogenesis factor FER-1 and human dysferlin, while the long form has six C2 domains. The homology suggests that this protein may be involved in vesicle membrane fusion. Several transcript variants encoding multipleisoforms have been found for this gene.

Synonyms: AUNB1 antibody|Deafness, autosomal recessive 9 antibody|DFNB6 antibody|DFNB9 antibody|Fer 1 like protein 2 antibody|Fer-1-like protein 2 antibody|FER1L2 antibody|NSRD9 antibody|Otof antibody|OTOF_HUMAN antibody|Otoferlin antibody

ID gène: 9381

Pathways: Sensory Perception of Sound, Synaptic Vesicle Exocytosis