DGAT1 anticorps (Middle Region)

N° du produit ABIN3043266

Détail du produit anti-DGAT1 anticorps

Antigène: DGAT1 (Diacylglycerol O-Acyltransferase 1 (DGAT1))

Épitope: AA 280-318, Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DGAT1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human,Rat.

Séquence: RRILEMLFFT QLQVGLIQQW MVPTIQNSMK PFKDMDYSR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human,Rat.
Gene Name: diacylglycerol O-acyltransferase 1
Protein Name: Diacylglycerol O-acyltransferase 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DGAT1

Antigène: DGAT1 (Diacylglycerol O-Acyltransferase 1 (DGAT1))

Autre désignation: DGAT1 (DGAT1 Produits)

Synonymes: anticorps ARAT, anticorps ARGP1, anticorps DGAT, anticorps C75990, anticorps D15Ertd23e, anticorps Dgat, anticorps dgat1, anticorps wu:fd36g11, anticorps zgc:77691, anticorps DGAT1, anticorps ABX45, anticorps AS11, anticorps ATDGAT, anticorps DIACYLGLYCEROL ACYLTRANSFERASE, anticorps F27F23.24, anticorps RDS1, anticorps TRIACYLGLYCEROL BIOSYNTHESIS DEFECT 1, anticorps DDBDRAFT_0202877, anticorps DDBDRAFT_0304727, anticorps DDB_0202877, anticorps DDB_0304727, anticorps zgc:92327, anticorps diacylglycerol O-acyltransferase 1, anticorps diacylglycerol O-acyltransferase 1a, anticorps diacylglycerol O-acyltransferase 1 L homeolog, anticorps membrane bound O-acyl transferase (MBOAT) family protein, anticorps diacylglycerol O-acyltransferase Dga1, anticorps diacylglycerol O-acyltransferase 1b, anticorps DGAT1, anticorps Dgat1, anticorps dgat1a, anticorps dgat1.L, anticorps TAG1, anticorps dgat1, anticorps MGYG_02131, anticorps Tsp_02502, anticorps LOC100283803, anticorps dga1, anticorps dgat1b

Sujet: Acyl-CoA: diacylglycerol acyltransferase (DGAT) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics.

Synonyms: ACAT related gene product 1 antibody|ACAT-related gene product 1 antibody|Acyl coenzyme A:cholesterol acyltransferase related gene 1 antibody|Acyl-CoA retinol O-fatty-acyltransferase antibody|Acyl-CoA:diacylglycerol acyltransferase antibody|ARAT antibody| ARGP1 antibody|C75990 antibody|D15Ertd23e antibody|Dgat antibody|DGAT1 antibody|DGAT1_HUMAN antibody|Diacylglycerol O acyltransferase 1 antibody|Diacylglycerol O-acyltransferase 1 antibody|DIAR7 antibody|Diglyceride acyltransferase antibody|EC 2.3.1.20 antibody| hCG_24006 antibody|MGC139064 antibody|Retinol O fatty acyltransferase antibody

ID gène: 8694

UniProt: O75907

Pathways: Hormone Transport