KCNIP2 anticorps (N-Term)
-
- Antigène Voir toutes KCNIP2 Anticorps
- KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))
-
Épitope
- AA 78-112, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp KCNIP2 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Fonction
- Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Séquence
- DEFELSTVCH RPEGLEQLQE QTKFTRKELQ VLYR
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Kv channel-interacting protein 2(KCNIP2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: Kv channel interacting protein 2
Protein Name: Kv channel-interacting protein 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human KChIP2 (78-112aa DEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYR), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product KCNIP2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- KCNIP2 (Kv Channel Interacting Protein 2 (KCNIP2))
- Autre désignation
- KCNIP2 (KCNIP2 Produits)
- Synonymes
- anticorps KCHIP2, anticorps KCNIP2, anticorps Kchip2, anticorps KChIP2, anticorps kchip2, anticorps si:ch73-173h19.2, anticorps potassium voltage-gated channel interacting protein 2, anticorps Kv channel-interacting protein 2, anticorps Kv channel interacting protein 2 S homeolog, anticorps Kv channel interacting protein 2, anticorps KCNIP2, anticorps Kcnip2, anticorps kcnip2.S, anticorps kcnip2
- Sujet
-
Kv channel-interacting protein 2 also known as KChIP2 is a protein that in humans is encoded by the KCNIP2 gene. This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins, which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. And they are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Alternative splicing results in multiple transcript variant encoding different isoforms.
Synonyms: A type potassium channel modulatory protein 2 antibody|A-type potassium channel modulatory protein 2 antibody|Cardiac voltage gated potassium channel modulatory subunit antibody|Cardiac voltage-gated potassium channel modulatory subunit antibody|DKFZp566L1246 antibody|KChIP 2 antibody|KChIP2 antibody|KCIP2_HUMAN antibody|KCNIP 2 antibody|Kcnip2 antibody|Kv channel interacting protein 2 antibody|Kv channel-interacting protein 2 antibody|MGC17241 antibody|Potassium channel interacting protein 2 antibody|Potassium channel-interacting protein 2 antibody - ID gène
- 30819
-