KNG1 anticorps (Middle Region)

N° du produit ABIN3043285

Détail du produit anti-KNG1 anticorps

Antigène: KNG1 (Kininogen 1 (KNG1))

Épitope: AA 227-259, Middle Region

Reactivité: Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KNG1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Kininogen-1(KNG1) detection. Tested with WB, IHC-P in Mouse.

Séquence: ECRGNLFMDI NNKIANFSQS CTLYSGDDLV EA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Kininogen-1(KNG1) detection. Tested with WB, IHC-P in Mouse.
Gene Name: kininogen 1
Protein Name: Kininogen-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of mouse Kininogen 1 (227-259aa ECRGNLFMDINNKIANFSQSCTLYSGDDLVEA L), different from the related rat sequence by thirteen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Mouse, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur KNG1

Antigène: KNG1 (Kininogen 1 (KNG1))

Autre désignation: KNG1 (KNG1 Produits)

Synonymes: anticorps BDK, anticorps BK, anticorps KNG, anticorps Kng, anticorps KNG2, anticorps fb64g01, anticorps wu:fb64g01, anticorps zgc:103569, anticorps kininogen, anticorps bdk, anticorps kng, anticorps KNG1, anticorps IHRP, anticorps KINKG, anticorps KINKH, anticorps Kng1, anticorps Kngk, anticorps kininogen 1, anticorps kininogen 1 L homeolog, anticorps inter-alpha-trypsin inhibitor heavy chain family member 4, anticorps kininogen 2-like 1, anticorps KNG1, anticorps Kng1, anticorps kng1, anticorps kng1.L, anticorps ITIH4, anticorps Kng2l1

Sujet: Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins - high - molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.

Synonyms: Alpha-2-thiol proteinase inhibitor antibody|BDK antibody|BK antibody|Bradykinin antibody|Fitzgerald factor antibody|High molecular weight kininogen antibody|HMWK antibody|Ile-Ser-Bradykinin antibody|Kallidin I antibody|Kallidin II antibody|Kininogen antibody|KNG antibody|KNG1 antibody|KNG1_HUMAN antibody|Low molecular weight growth-promoting factor antibody|Williams-Fitzgerald-Flaujeac factor antibody

ID gène: 16644

UniProt: O08677

Pathways: ACE Inhibitor Pathway, Glycosaminoglycan Metabolic Process