STXBP2 anticorps (N-Term)
-
- Antigène Voir toutes STXBP2 Anticorps
- STXBP2 (Syntaxin Binding Protein 2 (STXBP2))
-
Épitope
- AA 184-215, N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STXBP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.
- Séquence
- QEYPAIRYRK GPEDTAQLAH AVLAKLNAFK AD
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Syntaxin-binding protein 2(STXBP2) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: syntaxin binding protein 2
Protein Name: Syntaxin-binding protein 2 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product STXBP2 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- STXBP2 (Syntaxin Binding Protein 2 (STXBP2))
- Autre désignation
- STXBP2 (STXBP2 Produits)
- Synonymes
- anticorps zgc:85807, anticorps FHL5, anticorps Hunc18b, anticorps MUNC18-2, anticorps UNC18-2, anticorps UNC18B, anticorps pp10122, anticorps C79054, anticorps Munc-18-2, anticorps Munc-18b, anticorps Munc18b, anticorps Sxtbp2, anticorps Sxtp2, anticorps Unc18-2, anticorps Unc18b, anticorps muSec1, anticorps MUNC-18-2, anticorps syntaxin binding protein 2, anticorps stxbp2, anticorps STXBP2, anticorps Stxbp2
- Sujet
-
Syntaxin-binding protein 2, also known as UNC18B, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Synonyms: FHL5 antibody|Hunc18b antibody|MUNC18 2 antibody|pp10122 antibody|Protein unc-18 homolog 2 antibody|Protein unc-18 homolog B antibody| STXB2_HUMAN antibody|Stxbp2 antibody|syntaxin binding protein 2 antibody|Syntaxin-binding protein 2 antibody|Unc-18B antibody|UNC18 2 antibody|Unc18-2 antibody|UNC18B antibody - ID gène
- 6813
- UniProt
- Q15833
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis
-