SMC3 anticorps (C-Term)

N° du produit ABIN3043343

Détail du produit anti-SMC3 anticorps

Antigène: SMC3 (Structural Maintenance of Chromosomes 3 (SMC3))

Épitope: AA 1178-1216, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMC3 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: ELLESADKFY GVKFRNKVSH IDVITAEMAK DFVEDDTTH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Structural maintenance of chromosomes protein 3(SMC3) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: structural maintenance of chromosomes 3
Protein Name: Structural maintenance of chromosomes protein 3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SMC3

Antigène: SMC3 (Structural Maintenance of Chromosomes 3 (SMC3))

Autre désignation: SMC3 (SMC3 Produits)

Synonymes: anticorps cspg6, anticorps xsmc3, anticorps BAM, anticorps BMH, anticorps CDLS3, anticorps CSPG6, anticorps HCAP, anticorps SMC3L1, anticorps Bamacan, anticorps Cspg6, anticorps Mmip1, anticorps SMC-3, anticorps SmcD, anticorps im:7142991, anticorps wu:fb22e01, anticorps wu:fc30d07, anticorps bamacan, anticorps structural maintenance of chromosomes 3, anticorps structural maintenance of chromosomes 3 S homeolog, anticorps smc3, anticorps SMC3, anticorps Smc3, anticorps smc3.S

Sujet: Structural maintenance of chromosomes 3, also known as SMC3, is a human gene. This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Synonyms: BAM antibody|Bamacan antibody|Basement membrane associated chondroitin proteoglycan antibody|Basement membrane-associated chondroitin proteoglycan antibody|BMH antibody|CDLS3 antibody|chondroitin sulfate proteoglycan 6 (bamacan) antibody|Chondroitin sulfate proteoglycan 6 antibody|Chromosome associated polypeptide antibody|Chromosome-associated polypeptide antibody|CSPG 6 antibody|CSPG6 antibody|hCAP antibody|SMC 3 antibody|SMC protein 3 antibody|SMC-3 antibody|smc3 antibody|SMC3_HUMAN antibody|SMC3L1 antibody| Structural maintenance of chromosome 3 antibody|Structural maintenance of chromosomes 3 antibody|Structural maintenance of chromosomes protein 3 antibody

ID gène: 9126

Pathways: Stem Cell Maintenance