Sp2 anticorps (Middle Region)

N° du produit ABIN3043349

Détail du produit anti-Sp2 anticorps

Antigène: Sp2 (Sp2 Transcription Factor (Sp2))

Épitope: AA 312-343, Middle Region

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sp2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Transcription factor Sp2(SP2) detection. Tested with WB in Human,Rat.

Séquence: QVVQIPQQAL RVVQAASATL PTVPQKPSQN FQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Transcription factor Sp2(SP2) detection. Tested with WB in Human,Rat.
Gene Name: Sp2 transcription factor
Protein Name: Transcription factor Sp2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human SP2 (312-343aa QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Sp2

Antigène: Sp2 (Sp2 Transcription Factor (Sp2))

Autre désignation: SP2 (Sp2 Produits)

Synonymes: anticorps 4930480I16Rik, anticorps mKIAA0048, anticorps sp2, anticorps Sp2 transcription factor, anticorps Sp2 transcription factor S homeolog, anticorps SP2, anticorps Sp2, anticorps sp2.S

Sujet: Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.

Synonyms: Kiaa0048 antibody|OTTHUMP00000196580 antibody|SP2 antibody|SP2_HUMAN antibody|SPECIFICITY PROTEIN 2 antibody|Transcription factor Sp2 antibody

ID gène: 6668

UniProt: Q02086