LIMK2 anticorps (C-Term)

N° du produit ABIN3043412

Détail du produit anti-LIMK2 anticorps

Antigène: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Épitope: AA 596-635, C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIMK2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human,Mouse.

Séquence: KLEDSFEALS LYLGELGIPL PAELEELDHT VSMQYGLTRD

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for LIM domain kinase 2(LIMK2) detection. Tested with WB in Human,Mouse.
Gene Name: LIM domain kinase 2
Protein Name: LIM domain kinase 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2 (596-635aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD), different from the related mouse sequence by four amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur LIMK2

Antigène: LIMK2 (LIM Domain Kinase 2 (LIMK2))

Autre désignation: LIMK2 (LIMK2 Produits)

Synonymes: anticorps xlimk2, anticorps zgc:91990, anticorps wu:fa97c09, anticorps wu:fk73e11, anticorps LIMK2, anticorps Limk2b, anticorps Link2, anticorps LIMK, anticorps 9430059K01, anticorps A930024P04Rik, anticorps C85310, anticorps Limk2a, anticorps LIM domain kinase 2 L homeolog, anticorps LIM domain kinase 2, anticorps LIM motif-containing protein kinase 2, anticorps limk2.L, anticorps limk2, anticorps LIMK2, anticorps Limk2

Sujet: LIM domain kinase 2 is an enzyme that in humans is encoded by the LIMK2 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by this gene is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for this gene.

Synonyms: LIM domain kinase 2 antibody|LIMK 2 antibody|LIMK-2 antibody|Limk2 antibody|LIMK2_HUMAN antibody

ID gène: 3985

UniProt: P53671