Ataxin 2 anticorps (C-Term)

N° du produit ABIN3043507

Détail du produit anti-Ataxin 2 anticorps

Antigène: Ataxin 2 (ATXN2)

Épitope: AA 1283-1313, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ataxin 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Ataxin-2(ATXN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: QSALQPIPVS TTAHFPYMTH PSVQAHHQQQ L

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Ataxin-2(ATXN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: ataxin 2
Protein Name: Ataxin-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Ataxin 2

Antigène: Ataxin 2 (ATXN2)

Autre désignation: ATXN2 (ATXN2 Produits)

Synonymes: anticorps ASL13, anticorps ATX2, anticorps SCA2, anticorps TNRC13, anticorps 9630045M23Rik, anticorps AW544490, anticorps Sca2, anticorps ATXN2, anticorps MGC115230, anticorps ataxin 2, anticorps ataxin 2 L homeolog, anticorps ATXN2, anticorps Atxn2, anticorps atxn2.L

Sujet: Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.

Synonyms: Ataxin 2 antibody|ATXN2 antibody|Olivopontocerebellar ataxia 2, autosomal dominant antibody|SCA2 antibody|Spinocerebellar ataxia type 2 protein antibody|TNRC13 antibody| Trinucleotide repeat containing gene 13 protein antibody

ID gène: 6311

UniProt: Q99700

Pathways: Ribonucleoprotein Complex Subunit Organization