Aquaporin 1 anticorps (C-Term)

N° du produit ABIN3043524

Détail du produit anti-Aquaporin 1 anticorps

Antigène: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Épitope: AA 240-269, C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Aquaporin 1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DRVKVWTSGQ VEEYDLDADD INSRVEMKPK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Aquaporin-1(AQP1) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: aquaporin 1
Protein Name: Aquaporin-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Aquaporin 1 (240-269aa DRVKVWTSGQVEEYDLDADDINSRVEMKPK), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-Aquaporin 1 (ABIN3043524)

Zhang, Chen, Dong, Shi: "Effect of selective inhibition of aquaporin 1 on chemotherapy sensitivity of J82 human bladder cancer cells." dans: Oncology letters, Vol. 15, Issue 3, pp. 3864-3869, (2018) (PubMed).

Li, Zhao, Miao, Xu, Xiao, Liu: "Dynamic expression and roles of sequestome‑1/p62 in LPS‑induced acute kidney injury in mice." dans: Molecular medicine reports, Vol. 17, Issue 6, pp. 7618-7626, (2018) (PubMed).

Wang, Bu, Zhang, Chen, Zhang, Bao: "Expression pattern of aquaporins in patients with primary nephrotic syndrome with edema." dans: Molecular medicine reports, Vol. 12, Issue 4, pp. 5625-32, (2016) (PubMed).

Huo, Liu, Wang, Zhang, Wang, Yang, Sun, Xu: "Early hyperbaric oxygen therapy inhibits aquaporin 4 and adrenocorticotropic hormone expression in the pituitary gland of rabbits with blast-induced craniocerebral injury." dans: Neural regeneration research, Vol. 7, Issue 22, pp. 1729-35, (2015) (PubMed).

Zhang, Wu, Yang, Liu, Liu: "Effects of dexmedetomidine on the protection of hyperoxia-induced lung injury in newborn rats." dans: International journal of clinical and experimental pathology, Vol. 8, Issue 6, pp. 6466-73, (2015) (PubMed).

Ran, Wang, Chen, Zeng, Zhou, Zheng, Sun, Wang, Lv, Liang, Zhang, Liu: "Aquaporin-1 expression and angiogenesis in rabbit chronic myocardial ischemia is decreased by acetazolamide." dans: Heart and vessels, Vol. 25, Issue 3, pp. 237-47, (2010) (PubMed).

Détails sur Aquaporin 1

Antigène: Aquaporin 1 (AQP1) (Aquaporin 1 (Colton Blood Group) (AQP1))

Autre désignation: AQP1 (AQP1 Produits)

Synonymes: anticorps fj33g04, anticorps zgc:85890, anticorps wu:fj33g04, anticorps AQP1, anticorps CHIP28, anticorps AQP-CHIP, anticorps CO, anticorps AQP-1, anticorps CHIP29, anticorps aquaporin 1a (Colton blood group), tandem duplicate 1, anticorps aquaporin 1, anticorps aquaporin 1 (Colton blood group), anticorps aqp1a.1, anticorps AQP1, anticorps Aqp1

Sujet: Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Synonyms: AQP 1 antibody|AQP CHIP antibody|AQP-1 antibody|AQP1 antibody|AQP1_HUMAN antibody|Aquaporin CHIP antibody|Aquaporin-1 antibody|Aquaporin-CHIP antibody|Aquaporin1 antibody|Channel forming integral protein 28 kDa antibody|Channel like integral membrane protein 28 kDa antibody|CHIP 28 antibody| CHIP28 antibody|CO antibody|Colton blood group antibody|Growth factor induced delayed early response protein antibody|MGC26324 antibody|Urine water channel antibody|Water channel protein CHIP 29 antibody|Water channel protein CHIP29 antibody|Water channel protein for red blood cells and kidney proximal tubule antibody

ID gène: 358

UniProt: P29972

Pathways: Hormone Transport