Arc anticorps (C-Term)

N° du produit ABIN3043525

Cet anticorps Lapin Polyclonal détecte spécifiquement Arc dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour Arc anticorps (C-Term) (ABIN3043525)

Antigène: Arc (Activity-Regulated Cytoskeleton-Associated Protein (Arc))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Arc est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Arc anticorps

Épitope: AA 332-366, C-Term

Fonction: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human,Mouse,Rat.

Séquence: KLKRFLRHPL PKTLEQLIQR GMEVQDDLEQ AAEPA

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: activity-regulated cytoskeleton-associated protein
Protein Name: Activity-regulated cytoskeleton-associated protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Arc

Antigène: Arc (Activity-Regulated Cytoskeleton-Associated Protein (Arc))

Autre désignation: ARC

Sujet: ARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein first characterized in 1995. It is a member of the immediate-early gene (IEG) family. The ARC gene is mapped to chromosome 8q24. It has got 460 amino acid protein which shares significant similarity with rat Arc. The Arc is highly expressed in heart, brain, lung, skeletal muscle, pancreas, prostate and testis and has got weak expression in small intestine, colon, and peripheral blood leukocytes. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.

Synonyms: activity regulated cytoskeleton associated protein antibody|activity regulated gene 3.1 protein homolog antibody|Activity-regulated cytoskeleton-associated protein antibody|Activity-regulated gene 3.1 protein homolog antibody|Arc antibody|ARC/ARG3.1 antibody| ARC_HUMAN antibody|Arg3.1 antibody

ID gène: 23237