OTX2 anticorps (C-Term)

N° du produit ABIN3043586

Détail du produit anti-OTX2 anticorps

Antigène: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Épitope: AA 258-289, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OTX2 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Homeobox protein OTX2(OTX2) detection. Tested with WB in Human.

Séquence: DYKDQTASWK LNFNADCLDY KDQTSSWKFQ VL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Homeobox protein OTX2(OTX2) detection. Tested with WB in Human.
Gene Name: orthodenticle homeobox 2
Protein Name: Homeobox protein OTX2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Otx2 (258-289aa DYKDQTASWKLNFNADCLDYKDQTSSWKFQVL), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for Otx2 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur OTX2

Antigène: OTX2 (Orthodenticle Homeobox 2 (OTX2))

Autre désignation: OTX2 (OTX2 Produits)

Synonymes: anticorps CPHD6, anticorps MCOPS5, anticorps E130306E05Rik, anticorps id:ibd2915, anticorps zOtx2, anticorps zgc:136535, anticorps zotx-2, anticorps Xotx-2, anticorps Xotx2, anticorps otx-2, anticorps otx2, anticorps orthodenticle homeobox 2, anticorps orthodenticle homeobox 2 S homeolog, anticorps orthodenticle homeobox 2 L homeolog, anticorps OTX2, anticorps Otx2, anticorps otx2, anticorps otx2.S, anticorps otx2.L

Sujet: OTX2 is also known as CPHD6 or MCOPS5. This gene encodes a member of the bicoid subfamily of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and plays a role in brain, craniofacial, and sensory organ development. The encoded protein also influences the proliferation and differentiation of dopaminergic neuronal progenitor cells during mitosis. Mutations in this gene cause syndromic microphthalmia 5 (MCOPS5) and combined pituitary hormone deficiency 6 (CPHD6). This gene is also suspected of having an oncogenic role in medulloblastoma. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Pseudogenes of this gene are known to exist on chromosomes two and nine.

Synonyms: CPHD6 antibody|Homeobox protein OTX2 antibody|MCOPS 5 antibody|MCOPS5 antibody|MGC45000 antibody|Orthodenticle 2 antibody|Orthodenticle homeobox 2 antibody|Orthodenticle homolog 2 (Drosophila) antibody|Orthodenticle homolog 2 antibody|Orthodenticle2 antibody|Otx 2 antibody|otx2 antibody|OTX2_HUMAN antibody

ID gène: 5015

UniProt: P32243

Pathways: Dopaminergic Neurogenesis