PIM1 anticorps (C-Term)
-
- Antigène Voir toutes PIM1 Anticorps
- PIM1 (Pim-1 Oncogene (PIM1))
-
Épitope
- AA 373-404, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIM1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase pim-1(PIM1) detection. Tested with WB in Human.
- Séquence
- EEIQNHPWMQ DVLLPQETAE IHLHSLSPGP SK
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase pim-1(PIM1) detection. Tested with WB in Human.
Gene Name: Pim-1 proto-oncogene, serine/threonine kinase
Protein Name: Serine/threonine-protein kinase pim-1 - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human PIM1(373-404aa EEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK), different from the related mouse sequence by seven amino acids and from the related rat sequence by two amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product PIM1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, The detection limit for PIM1 is approximately 0.1 ng/lane under reducing conditions.
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
PIM1 polymorphism and PIM1 expression as predisposing factors of esophageal squamous cell carcinoma in the Asian population." dans: OncoTargets and therapy, Vol. 9, pp. 2919-25, (2016) (PubMed).
: "
-
PIM1 polymorphism and PIM1 expression as predisposing factors of esophageal squamous cell carcinoma in the Asian population." dans: OncoTargets and therapy, Vol. 9, pp. 2919-25, (2016) (PubMed).
-
- Antigène
- PIM1 (Pim-1 Oncogene (PIM1))
- Autre désignation
- PIM1 (PIM1 Produits)
- Synonymes
- anticorps PIM, anticorps Pim-1, anticorps PIM1, anticorps pim, anticorps pim-1, anticorps pim3, anticorps Pim-1 proto-oncogene, serine/threonine kinase, anticorps proviral integration site 1, anticorps Pim-1 proto-oncogene, serine/threonine kinase L homeolog, anticorps PIM1, anticorps Pim1, anticorps pim1, anticorps pim1.L
- Sujet
-
Proto-oncogene serine/threonine-protein kinase Pim-1 is an enzyme that in humans is encoded by the PIM1 gene. It is mapped to 6p21.2. Primarily expressed in spleen, thymus, bone marrow, prostate, oral epithelial, hippocampus and fetal liver cells, Pim-1 has also been found to be highly expressed in cell cultures isolated from human tumors. Pim-1 is mainly involved in cell cycle progression, apoptosis and transcriptional activation, as well as more general signal transduction pathways. It has been found a physiologic role of the PIM1 oncogene during hematopoietic development and a deregulation of the gene in various leukemias. PIM1 also has a role in cardioprotection downstream of AKT activation.
Synonyms: Oncogene PIM 1 antibody|Oncogene PIM1 antibody|PIM 1 antibody|pim 1 kinase 44 kDa isoform antibody|Pim 1 kinase antibody|pim 1 oncogene (proviral integration site 1) antibody|Pim 1 oncogene antibody|PIM antibody|PIM1 antibody|pim1 kinase 44 kDa isoform antibody|PIM1_HUMAN antibody|Pim2 antibody|PIM3 antibody|Proto oncogene serine/threonine protein kinase Pim 1 antibody|Proto-oncogene serine/threonine-protein kinase Pim-1 antibody|Proviral integration site 1 antibody|Proviral integration site 2 antibody - ID gène
- 5292
- UniProt
- P11309
- Pathways
- Glycosaminoglycan Metabolic Process
-