GREM1 anticorps (C-Term)

N° du produit ABIN3043836

Détail du produit anti-GREM1 anticorps

Antigène: GREM1 (Gremlin 1 (GREM1))

Épitope: AA 151-184, C-Term

Reactivité: Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GREM1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Gremlin-1(GREM1) detection. Tested with WB in Human,Rat.

Séquence: TMMVTLNCPE LQPPTKKKRV TRVKQCRCIS IDLD

Réactivité croisée (Details): Predicted Cross Reactivity: human
No cross reactivity with other proteins.
Predicted Cross Reactivity: Species predicted to be fit for the product based on sequence similarities.

Attributs du produit: Rabbit IgG polyclonal antibody for Gremlin-1(GREM1) detection. Tested with WB in Human,Rat.
Gene Name: gremlin 1
Protein Name: Gremlin-1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Rat, Predicted Species: Human
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur GREM1

Antigène: GREM1 (Gremlin 1 (GREM1))

Autre désignation: GREM1 (GREM1 Produits)

Synonymes: anticorps grem1, anticorps MGC136702, anticorps zgc:136702, anticorps GREM1, anticorps drm, anticorps pig2, anticorps dand2, anticorps ihg-2, anticorps gremlin, anticorps Cktsf1b1, anticorps Drm, anticorps Grem, anticorps ld, anticorps gremlin-1, anticorps CKTSF1B1, anticorps DAND2, anticorps DRM, anticorps GREMLIN, anticorps IHG-2, anticorps cktsf1b1, anticorps gremlin 1a, DAN family BMP antagonist, anticorps gremlin 1, DAN family BMP antagonist, anticorps gremlin 1, anticorps gremlin 1, DAN family BMP antagonist L homeolog, anticorps grem1a, anticorps GREM1, anticorps LOC662541, anticorps grem1, anticorps Grem1, anticorps grem1.L

Sujet: Gremlin, also known as Drm, is a highly conserved 20.7- kDa, 184 amino acid glycoprotein part of the DAN family and is a cysteine knot-secreted protein. Skeletal cells synthesize bone morphogenetic proteins (BMPs) and BMP antagonists. And Gremlin is expressed in osteoblasts and opposes BMP effects on osteoblastic differentiation and function in vitro. Gremlin 1 (GREM 1) is known for its antagonistic reaction with BMPs in the TGF beta signaling pathway. This gene inhibits BMP-2, BMP-4, and BMP-7. Inhibition by grem 1 of BMPs in mice allow the expression of fibroblast growth factors (FGFs) 4 and 8 and Sonic hedgehog (SHH) which are necessary for proper limb development. Gremlin 1 may play an oncogenic role especially in carcinomas of the uterine cervix, lung, ovary, kidney, breast, colon, pancreas, and sarcoma. Over-expressed gremlin 1 functions by interaction with YWHAH (Its binding site for gremlin 1 was located between residues 61-80 and gremlin 1 binding site for YWHAH was found to be located between residues 1-67). Therefore, Gremlin 1 and its binding protein YWHAH could be good targets for developing diagnostic and therapeutic strategies against human cancers.

Synonyms: BMP antagonist 1 antibody|Cell proliferation inducing gene 2 protein antibody|Cell proliferation-inducing gene 2 protein antibody| CKTSF1B1 antibody|Cysteine knot superfamily 1 antibody|Cysteine knot superfamily 1, BMP antagonist 1 antibody|Cysteine knot superfamily BMP antagonist 1 antibody|DAN domain family member 2 antibody|DAND2 antibody|Down regulated in Mos-transformed cells protein antibody|Down-regulated in Mos-transformed cells protein antibody|DRM antibody|grem1 antibody|GREM1_HUMAN antibody|Gremlin 1 like protein antibody| Gremlin 1, cysteine knot superfamily, homolog antibody|GREMLIN antibody|Gremlin-1 antibody| Gremlin1 antibody| IHG-2 antibody|IHG2 antibody|Increased in high glucose 2 antibody| Increased in high glucose protein 2 antibody|PIG2 antibody| Proliferation inducing gene 2 antibody|proliferation inducing gene 2 protein antibody

ID gène: 26585

UniProt: O60565

Pathways: Regulation of Muscle Cell Differentiation, Tube Formation, Maintenance of Protein Location