Monoamine Oxidase A anticorps (C-Term)

N° du produit ABIN3043872

Détail du produit anti-Monoamine Oxidase A anticorps

Antigène: Monoamine Oxidase A (MAOA)

Épitope: AA 457-493, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Monoamine Oxidase A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] A(MAOA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: REVLNGLGKV TEKDIWVQEP ESKDVPAVEI THTFWER

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] A(MAOA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: monoamine oxidase A
Protein Name: Amine oxidase [flavin-containing] A

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOA (457-493aa REVLNGLGKVTEKDIWVQEPESKDVPAVEITHTFWER), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Monoamine Oxidase A

Antigène: Monoamine Oxidase A (MAOA)

Autre désignation: MAOA (MAOA Produits)

Synonymes: anticorps MAO-A, anticorps 1110061B18Rik, anticorps AA407771, anticorps Mao, anticorps MAOA, anticorps LOC100221249, anticorps Z-MAO, anticorps maob, anticorps moa, anticorps wu:fb68b05, anticorps wu:fo76d11, anticorps wu:fq38g06, anticorps zgc:85761, anticorps monoamine oxidase A, anticorps monoamine oxidase A L homeolog, anticorps amine oxidase [flavin-containing] A, anticorps monoamine oxidase, anticorps MAOA, anticorps Maoa, anticorps maoa.L, anticorps mll3668, anticorps maoa, anticorps LOC100221249, anticorps mao

Sujet: MAOA(Monoamine oxidase A), also known as AMINE OXIDASE (FLAVIN-CONTAINING) A, is an enzyme that in humans is encoded by the MAO-A gene. MAOA is an isozyme of monoamine oxidase which is also mapped on Xp11.3. MAOA degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the outer mitochondrial membrane. Mutation in MAOA results in monoamine oxidase deficiency, or Brunner syndrome. In humans, there is a 30-base repeat sequence repeated in one of several different numbers of times in the promoter region of the gene coding for MAOA. MAO-A levels in the brain as measured using positron emission tomography are elevated by an average of 34 % in patients with major depressive disorder. Inhibition of MAOA prevented apoptosis, and serum starvation of cortical brain cells from Maoa-deficient mice resulted in reduced apoptosis compared with wildtype mice.

Synonyms: Amine oxidase [flavin containing] A antibody|Amine oxidase [flavin-containing] A antibody|AOFA antibody|AOFA_HUMAN antibody|EC 1.4.3.4 antibody|MAO A antibody|MAO-A antibody|Maoa antibody|Monoamine oxidase A antibody|Monoamine oxidase type A antibody

ID gène: 4128

UniProt: P21397