Monoamine Oxidase B anticorps (C-Term)

N° du produit ABIN3043873

Détail du produit anti-Monoamine Oxidase B anticorps

Antigène: Monoamine Oxidase B (MAOB)

Épitope: AA 448-484, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Monoamine Oxidase B est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] B(MAOB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: REILHAMGKI PEDEIWQSEP ESVDVPAQPI TTTFLER

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Amine oxidase [flavin-containing] B(MAOB) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: monoamine oxidase B
Protein Name: Amine oxidase [flavin-containing] B

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human MAOB (448-484aa REILHAMGKIPEDEIWQSEPESVDVPAQPITTTFLER), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Monoamine Oxidase B

Antigène: Monoamine Oxidase B (MAOB)

Autre désignation: MAOB (MAOB Produits)

Synonymes: anticorps MAOB, anticorps Z-MAO, anticorps maob, anticorps moa, anticorps wu:fb68b05, anticorps wu:fo76d11, anticorps wu:fq38g06, anticorps zgc:85761, anticorps MAOA, anticorps 6330414K01Rik, anticorps MAO-B, anticorps monoamine oxidase B, anticorps amine oxidase [flavin-containing] B, anticorps monoamine oxidase, anticorps monoamine oxidase B L homeolog, anticorps MAOB, anticorps Gbro_4276, anticorps LOC100223232, anticorps mao, anticorps Maob, anticorps maob.L

Sujet: MAOB (MONOAMINE OXIDASE B), also called MAO, BRAIN, AMINE OXIDASE (FLAVIN-CONTAINING) B, is a protein that in humans is encoded by the MAOB gene. MAOB is a member of the flavin monoamine oxidase family. And it is mapped on Xp11.3. MAOB catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine. Like MAOA, it also degrades dopamine. MAO-B is involved in the breakdown of dopamine, a neurotransmitter implicated in reinforcing and motivating behaviors as well as movement. MAO-B inhibition is, therefore, associated with enhanced activity of dopamine, as well as with decreased production of hydrogen peroxide, a source of reactive oxygen species.

Synonyms: Adrenalin oxidase antibody|Amine oxidase (flavin containing) antibody|Amine oxidase [flavin-containing] B antibody|AOFB_HUMAN antibody|HGNC:6834 antibody|MAO, brain antibody| MAO, platelet antibody|MAO-B antibody|MAOB antibody|MGC26382 antibody|Monoamine oxidase B antibody|Monoamine oxidase type B antibody|OTTHUMP00000023166 antibody|RP1 201D17__B.1 antibody|Tyramine oxidase antibody

ID gène: 4129

UniProt: P27338