MGA (AA 2376-2415), (C-Term) anticorps
-
- Antigène
- MGA
-
Épitope
- AA 2376-2415, C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Inconjugué
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for MAX gene-associated protein(MGA) detection. Tested with WB in Human.
- Séquence
- QKEAEAFAYY RRTHTANERR RRGEMRDLFE KLKITLGLLH
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for MAX gene-associated protein(MGA) detection. Tested with WB in Human.
Gene Name: MGA, MAX dimerization protein
Protein Name: MAX gene-associated protein - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH), different from the related mouse sequence by two amino acids.
- Isotype
- IgG
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- MGA
- Sujet
-
Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus, GAS) in response to changing environmental conditions. It had been found that the mouse transcription factor Max interacted with Mga. Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells. EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG. The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max. Mga repressed transcription of a reporter driven from a T-box-binding site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site. Expression of Mga with Max, but not Mga alone, activated transcription from a reporter containing the E-box site.
Synonyms: MAD5 antibody|MAX dimerization protein 5 antibody|MAX gene associated antibody|MAX gene associated protein antibody|Max interacting protein antibody|MGAM antibody|MXD5 antibody - ID gène
- 23269
-