STIP1 anticorps (C-Term)

N° du produit ABIN3044551

Détail du produit anti-STIP1 anticorps

Antigène: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Épitope: AA 505-543, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STIP1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Stress-induced-phosphoprotein 1(STIP1) detection. Tested with WB in Human,Rat.

Séquence: RLILEQMQKD PQALSEHLKN PVIAQKIQKL MDVGLIAIR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Stress-induced-phosphoprotein 1(STIP1) detection. Tested with WB in Human,Rat.
Gene Name: stress induced phosphoprotein 1
Protein Name: Stress-induced-phosphoprotein 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human STIP1 (505-543aa RLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur STIP1

Antigène: STIP1 (Stress-Induced-phosphoprotein 1 (STIP1))

Autre désignation: STIP1 (STIP1 Produits)

Synonymes: anticorps HOP, anticorps IEF-SSP-3521, anticorps P60, anticorps STI1, anticorps STI1L, anticorps Hop, anticorps Sti1, anticorps p60, anticorps MGC53256, anticorps stip1, anticorps MGC76181, anticorps MGC82554, anticorps zgc:92133, anticorps stress induced phosphoprotein 1, anticorps stress-induced phosphoprotein 1, anticorps stress induced phosphoprotein 1 L homeolog, anticorps Stress-induced-phosphoprotein 1, anticorps stress-induced-phosphoprotein 1, anticorps stress induced phosphoprotein 1 S homeolog, anticorps STIP1, anticorps Stip1, anticorps stip1.L, anticorps GL50803_27310, anticorps PGTG_06468, anticorps stip1, anticorps stip1.S

Sujet: STIP1 is an adaptor protein that coordinates the functions of HSP70 and HSP90 in protein folding. It is thought to assist in the transfer of proteins from HSP70 to HSP90 by binding both HSP90 and substrate-bound HSP70. STIP1 also stimulates the ATPase activity of HSP70 and inhibits the ATPase activity of HSP90, suggesting that it regulates both the conformations and ATPase cycles of these chaperones. The International Radiation Hybrid Mapping Consortium mapped the STIP1 gene to 11q13.

Synonyms: Epididymis secretory sperm binding protein Li 94n antibody|HEL S 94n antibody|Hop antibody|Hsc70/Hsp90 organizing protein antibody| Hsc70/Hsp90-organizing protein antibody|IEF SSP 3521 antibody|NY REN 11 antigen antibody|P60 antibody|Renal carcinoma antigen NY-REN-11 antibody|STI1 antibody|STI1L antibody|STIP1 antibody|STIP1_HUMAN antibody|Stress induced phosphoprotein 1 antibody|Stress-induced-phosphoprotein 1 antibody|Transformation sensitive protein IEF SSP 3521 antibody|Transformation-sensitive protein IEF SSP 3521 antibody

ID gène: 10963

UniProt: P31948