VRK1 anticorps (C-Term)

N° du produit ABIN3044560

Détail du produit anti-VRK1 anticorps

Antigène: VRK1 (Vaccinia Related Kinase 1 (VRK1))

Épitope: AA 292-329, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VRK1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase VRK1(VRK1) detection. Tested with WB in Human,Rat.

Séquence: EKNKPGEIAK YMETVKLLDY TEKPLYENLR DILLQGLK

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase VRK1(VRK1) detection. Tested with WB in Human,Rat.
Gene Name: vaccinia related kinase 1
Protein Name: Serine/threonine-protein kinase VRK1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292-329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK), different from the related mouse sequence by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur VRK1

Antigène: VRK1 (Vaccinia Related Kinase 1 (VRK1))

Autre désignation: VRK1 (VRK1 Produits)

Synonymes: anticorps vrk1, anticorps MGC64390, anticorps MGC75762, anticorps VRK1, anticorps PCH1, anticorps PCH1A, anticorps 51PK, anticorps wu:fe16f06, anticorps zgc:56266, anticorps vaccinia related kinase 1 L homeolog, anticorps vaccinia related kinase 1, anticorps Serine/threonine-protein kinase VRK1, anticorps vrk1.L, anticorps vrk1, anticorps VRK1, anticorps vrk-1, anticorps Vrk1

Sujet: Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene. This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 Molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.

Synonyms: MGC117401 antibody|MGC138280 antibody|MGC142070 antibody|PCH1 antibody|PCH1A antibody|Serine/threonine protein kinase VRK1 antibody| Serine/threonine-protein kinase VRK1 antibody|Vaccinia related kinase 1 antibody|Vaccinia virus B1R related kinase 1 antibody| Vaccinia-related kinase 1 antibody|VRK1 antibody|VRK1_HUMAN antibody

ID gène: 7443

UniProt: Q99986