Tel:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@anticorps-enligne.fr

Integrin alpha 3B, alpha 6B anticorps

Il existe 1 publication pour ce produit. L’anticorps anti-Integrin alpha 3B, alpha 6B Monoclonal Souris est utilisé pour la détection de Integrin alpha 3B, alpha 6B dans des échantillons de Humain. Il a été validé pour ICC, IHC (fro), IHC et WB.
N° du produit ABIN335348
544,85 €
Plus frais de livraison 40,00 € et TVA
100 μg
Destination: France
Envoi sous 2 à 4 jours ouvrables

Aperçu rapide pour Integrin alpha 3B, alpha 6B anticorps (ABIN335348)

Antigène

Integrin alpha 3B, alpha 6B

Reactivité

Humain

Hôte

Souris

Clonalité

Monoclonal

Application

Immunocytochemistry (ICC), Immunohistochemistry (Frozen Sections) (IHC (fro)), Immunohistochemistry (IHC), Western Blotting (WB)

Clone

PB36
  • Specificité

    Human. A broad species reactivity is expected because of the conserved nature of the epitope.

    Purification

    Purified

    Immunogène

    PB36 is a mouse monoclonal IgG1, kappa antibody derived by fusion of SP2/0 mouse myeloma cells with spleen cells from a BALB/c mouse immunized with a synthetic peptide corresponding to a 32 amino acid stretch in the cytoplasmic domain of integrin alpha3B including an appending N-terminal cysteine (CTRYYQIMPKYHAVRIREEERYPPPGSTLPTKK) coupled to keyhole limpet hemocyanin.

    Isotype

    IgG1
  • Indications d'application

    PB36 recognizes the cytoplasmic domain of integrin subunits alpha3B and alpha6B. PB36 reacts with the basement membrane zone and endothelial cells in skin, tubuli in kidney and all vascular and capillary endothelia in brain and heart. PB36 is suitable for immunoblotting, immunocytochemistry and immunohistochemistry on frozen tissues. Optimal antibody dilution should be determined by titration, recommended range is 1:50 - 1:100 for immunohistochemistry with avidin-biotinylated horseradish peroxidase complex (ABC) as detection reagent, and 1:100 - 1:500 for immunoblotting applications.

    Restrictions

    For Research Use only
  • Stock

    4 °C
  • de Melker, Sterk, Delwel, Fles, Daams, Weening, Sonnenberg: "The A and B variants of the alpha 3 integrin subunit: tissue distribution and functional characterization." dans: Laboratory investigation; a journal of technical methods and pathology, Vol. 76, Issue 4, pp. 547-63, (1997) (PubMed).

  • Antigène

    Integrin alpha 3B, alpha 6B

    Autre désignation

    Integrin alpha 3B+alpha 6B

    Sujet

    Integrins are a family of heterodimeric membrane glycoproteins consisting of non-covalently associated alpha and beta subunits. More than 18 alpha and 8 beta subunits with numerous splice variant isoforms have been identified in mammals. In general, integrins function as receptors for extracellular matrix proteins. Certain integrins can also bind to soluble ligands or to counter-receptors on adjacent cells, such as the intracellular adhesion molecules (ICAMs), resulting in aggregation of cells. Signals transduced by integrins play a role in many biological processes, including cell growth, differentiation, migration and apoptosis. For integrin subunits alpha3 and alpha6, two cytoplasmic variants, A and B, have been identified.
Vous êtes ici:
Chat with us!