Adenylate Kinase 1 anticorps (C-Term)

N° du produit ABIN4886445

Détail du produit anti-Adenylate Kinase 1 anticorps

Antigène: Adenylate Kinase 1 (AK1)

Épitope: AA 149-189, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Adenylate Kinase 1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: RLETYYKATE PVIAFYEKRG IVRKVNAEGS VDSVF

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Adenylate kinase isoenzyme 1(AK1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: adenylate kinase 1
Protein Name: Adenylate kinase isoenzyme 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Adenylate Kinase 1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVF SQVCTH), different from the related mouse sequence by seven amino acids, and from the related rat sequence by four amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Adenylate Kinase 1

Antigène: Adenylate Kinase 1 (AK1)

Autre désignation: AK1 (AK1 Produits)

Synonymes: anticorps ADK-1, anticorps AK1, anticorps CG17146, anticorps DAK1, anticorps Dak1, anticorps Dmel\\CG17146, anticorps adk1, anticorps bs34e10.y1, anticorps ak5, anticorps ADENYLATE KINASE 1, anticorps MLE2.3, anticorps MLE2_3, anticorps adenylate kinase 1, anticorps Ak-1, anticorps B430205N08Rik, anticorps Ak 1, anticorps zgc:91930, anticorps Myokinase, anticorps Adenylate kinase 1, anticorps adenylate kinase 1, anticorps Adk1, anticorps ak1, anticorps AK1, anticorps ADK1, anticorps Ak1

Sujet: This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Synonyms: Adenylate kinase 1 | AK 1 | AK1 | ATP-AMP transphosphorylase 1 | KAD1 | Myokinase | P00568

ID gène: 203

UniProt: P00568

Pathways: Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process