APRT anticorps (N-Term)

N° du produit ABIN4886471

Détail du produit anti-APRT anticorps

Antigène: APRT (Adenine Phosphoribosyltransferase (APRT))

Épitope: AA 5-49, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp APRT est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection. Tested with WB in Human.

Séquence: ELQLVEQRIR SFPDFPTPGV VFRDISPVLK DPASFRAAIG LLARH

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Adenine phosphoribosyltransferase(APRT) detection. Tested with WB in Human.
Gene Name: adenine phosphoribosyltransferase
Protein Name: Adenine phosphoribosyltransferase

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human APRT (5-49aa ELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARH), different from the related mouse sequence by ten amino acids, and from the related rat sequence by nine amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur APRT

Antigène: APRT (Adenine Phosphoribosyltransferase (APRT))

Autre désignation: APRT (APRT Produits)

Synonymes: anticorps Tb07.43M14.200, anticorps Tb07.43M14.180, anticorps C85684, anticorps AMP, anticorps APRTD, anticorps adenine phosphoribosyltransferase, anticorps adenine phosphoribosyl transferase, anticorps CND05020, anticorps Tb927.7.1790, anticorps Tb927.7.1780, anticorps Arnit_0941, anticorps Saut_1231, anticorps Fbal_1180, anticorps PH_RS07970, anticorps PF_RS08760, anticorps PAB_RS02560, anticorps Aprt, anticorps APRT

Sujet: Adenine phosphoribosyltransferase (APRTase) is an enzyme encoded by the APRT gene, found in humans on chromosome 16. It belongs to the purine/pyrimidine phosphoribosyltransferase family. A conserved feature of this gene is the distribution of CpG dinucleotides. This enzyme catalyzes the formation of AMP and inorganic pyrophosphate from adenine and 5-phosphoribosyl-1-pyrophosphate (PRPP). It also produces adenine as a by-product of the polyamine biosynthesis pathway. A homozygous deficiency in this enzyme causes 2,8-dihydroxyadenine urolithiasis. Two transcript variants encoding different isoforms have been found for this gene.

Synonyms: AMP | AMP diphosphorylase | AMP pyrophosphorylase | APRT | APRTD | Transphosphoribosidase | P07741

ID gène: 353

UniProt: P07741

Pathways: Ribonucleoside Biosynthetic Process