Cofilin 2 anticorps (C-Term)

N° du produit ABIN4886538

Détail du produit anti-Cofilin 2 anticorps

Antigène: Cofilin 2 (CFL2)

Épitope: AA 121-153, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cofilin 2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Cofilin-2(CFL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: KDAIKKKFTG IKHEWQVNGL DDIKDRSTLG EKL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Cofilin-2(CFL2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: cofilin 2
Protein Name: Cofilin-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur Cofilin 2

Antigène: Cofilin 2 (CFL2)

Autre désignation: CFL2 (CFL2 Produits)

Synonymes: anticorps NEM7, anticorps CFL2, anticorps zgc:77288, anticorps cf12, anticorps cofilin 2, anticorps cofilin 2 (non-muscle), anticorps cofilin 2 (muscle), anticorps cofilin 2, muscle, anticorps cofilin-2, anticorps CFL2, anticorps cfl2, anticorps Cfl2, anticorps cf12, anticorps LOC100359205

Sujet: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH -dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.

Synonyms: CFL 2 | CFL2 | CFL-2 | Cofilin 2 muscle | Cofilin | Cofilin muscle | Cofilin2 | Cofilin 2 | Cofilin-2 | NEM 7 | NEM7 | Q9Y281

ID gène: 1073

UniProt: Q9Y281

Pathways: Caspase Cascade in Apoptosis