CPM anticorps (C-Term)

N° du produit ABIN4886547

Détail du produit anti-CPM anticorps

Antigène: CPM (Carboxypeptidase M (CPM))

Épitope: AA 286-316, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CPM est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection. Tested with WB in Human.

Séquence: KYPREEKLPS FWNNNKASLI EYIKQVHLGV K

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Carboxypeptidase M(CPM) detection. Tested with WB in Human.
Gene Name: carboxypeptidase M
Protein Name: Carboxypeptidase M

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human CPM (286-316aa KYPREEKLPSFWNNNKASLIEYIKQVHLGVK), different from the related mouse sequence by two amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur CPM

Antigène: CPM (Carboxypeptidase M (CPM))

Autre désignation: CPM (CPM Produits)

Synonymes: anticorps im:7143022, anticorps im:7143022l, anticorps si:dkey-11p6.1, anticorps zgc:110307, anticorps CPM, anticorps 1110060I01Rik, anticorps 5730456K23Rik, anticorps AA589379, anticorps E030045M14Rik, anticorps carboxypeptidase M, anticorps carboxypeptidase D, anticorps CPM, anticorps cpm, anticorps LOC5574253, anticorps Cpm

Sujet: CPM, mapped to 12q15, is known as Carboxypeptidase M. The protein encoded by this gene is a membrane-bound arginine/lysine carboxypeptidase. Its expression is associated with monocyte to macrophage differentiation. This encoded protein contains hydrophobic regions at the amino and carboxy termini and has 6 potential asparagine-linked glycosylation sites. The active site residues of carboxypeptidases A and B are conserved in this protein. Three alternatively spliced transcript variants encoding the same protein have been described for this gene.

Synonyms: Carboxypeptidase M | CPM | Renal carboxypeptidase | Urinary carboxypeptidase B | P14384

ID gène: 1368

UniProt: P14384