DDAH1 anticorps (C-Term)

N° du produit ABIN4886560

Détail du produit anti-DDAH1 anticorps

Antigène: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Épitope: AA 195-226, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDAH1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: QKALKIMQQM SDHRYDKLTV PDDIAANCIY LN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 1(DDAH1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: dimethylarginine dimethylaminohydrolase 1
Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH1 (195-226aa QKALKIMQQMSDHRYDKLTVPDDIAANCIYLN), different from the related mouse and rat sequences by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DDAH1

Antigène: DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))

Autre désignation: DDAH1 (DDAH1 Produits)

Synonymes: anticorps DDAH, anticorps 2410006N07Rik, anticorps 2510015N06Rik, anticorps AI987801, anticorps AW050362, anticorps DDAH1, anticorps wu:fc30c11, anticorps zgc:85829, anticorps dimethylarginine dimethylaminohydrolase 1, anticorps dimethylarginine dimethylaminohydrolase 1 L homeolog, anticorps DDAH1, anticorps Ddah1, anticorps ddah1.L, anticorps ddah1

Sujet: DDAH1 is knowns as dimethylarginine dimethylaminohydrolase 1 which is mapped to chromosome 1p22 by radiation hybrid and FISH analysis. This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family. DDAH1 plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. It widely expressed, especially in liver and kidney.

Synonyms: DDAH 1 | DDAH1 | DDAH | Dimethylargininase-1 | Dimethylargininase 1 | O94760

ID gène: 23576

UniProt: O94760