DDAH2 anticorps (C-Term)

N° du produit ABIN4886561

Détail du produit anti-DDAH2 anticorps

Antigène: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Épitope: AA 190-224, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDAH2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 2(DDAH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: DAAQKAVRAM AVLTDHPYAS LTLPDDAAAD CLFLR

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for N(G),N(G)-dimethylarginine dimethylaminohydrolase 2(DDAH2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: dimethylarginine dimethylaminohydrolase 2
Protein Name: N(G),N(G)-dimethylarginine dimethylaminohydrolase 2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190-224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR), different from the related mouse and rat sequences by three amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur DDAH2

Antigène: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Autre désignation: DDAH2 (DDAH2 Produits)

Synonymes: anticorps ddah2, anticorps MGC84290, anticorps g6a, anticorps ddah, anticorps ng30, anticorps ddahii, anticorps MGC89103, anticorps DDAH2, anticorps DDAH, anticorps DDAHII, anticorps G6a, anticorps NG30, anticorps 1110003M04Rik, anticorps AU019324, anticorps AW413173, anticorps DDAH-2, anticorps Ddah, anticorps dimethylarginine dimethylaminohydrolase 2, anticorps dimethylarginine dimethylaminohydrolase 2 L homeolog, anticorps ddah2, anticorps ddah2.L, anticorps DDAH2, anticorps Ddah2

Sujet: DDAH2 is known as dimethylarginine dimethylaminohydrolase 2 which is mapped to 6p21.3 by radiation hybrid and FISH analysis. This gene encodes a dimethylarginine dimethylaminohydrolase. DDAH2 functions in nitric oxide generation by regulating the cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity. The protein may be localized to the mitochondria. Alternative splicing resulting in multiple transcript variants.

Synonyms: DDAH | DDAH II | DDAHII | DDAH2 | DDAH-2 | DDAH 2 | Dimethylargininase 2 | Dimethylargininase-2 | G6a | NG30 | Protein G6a | S phase protein | S-phase protein | O95865

ID gène: 23564

UniProt: O95865