EpCAM anticorps (Middle Region)

N° du produit ABIN4886570

Détail du produit anti-EpCAM anticorps

Antigène: EpCAM (EPCAM) (Epithelial Cell Adhesion Molecule (EPCAM))

Épitope: AA 147-189, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EpCAM est non-conjugé

Application: Western Blotting (WB), Flow Cytometry (FACS), ELISA, Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection. Tested with WB, IHC-P, ELISA, FCM in Human.

Séquence: ELKHKAREKP YDSKSLRTAL QKEITTRYQL DPKFITSILY ENN

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Epithelial cell adhesion molecule(EPCAM) detection. Tested with WB, IHC-P, ELISA, FCM in Human.
Gene Name: epithelial cell adhesion molecule
Protein Name: Epithelial cell adhesion molecule

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
ELISA: Concentration: 0.1-0.5 μg/mL, Tested Species: Human

Flow Cytometry: Concentration:1-3 μg/1x106 cells, Tested Species: Human
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-EpCAM (ABIN4886570)

Huang, Li, Pan, Cheng, Ren, Jia, Ma, Xu: "A novel multi-target RNAi adenovirus inhibits hepatoma cell proliferation, migration, and induction of angiogenesis." dans: Oncotarget, Vol. 7, Issue 36, pp. 57705-57713, (2018) (PubMed).

Zhang, Bu, Sun, Xu, Yao, He, Lai: "Paracrine effects of human amniotic epithelial cells protect against chemotherapy-induced ovarian damage." dans: Stem cell research & therapy, Vol. 8, Issue 1, pp. 270, (2018) (PubMed).

Détails sur EpCAM

Antigène: EpCAM (EPCAM) (Epithelial Cell Adhesion Molecule (EPCAM))

Autre désignation: EPCAM (EPCAM Produits)

Synonymes: anticorps DIAR5, anticorps EGP-2, anticorps EGP314, anticorps EGP40, anticorps ESA, anticorps HNPCC8, anticorps KS1/4, anticorps KSA, anticorps M4S1, anticorps MIC18, anticorps MK-1, anticorps TACSTD1, anticorps TROP1, anticorps ECS-1, anticorps ECS1, anticorps ESA1, anticorps M17S1, anticorps EGP, anticorps Ep-CAM, anticorps sb:cb6, anticorps tacstd, anticorps wu:fj17g02, anticorps zgc:110304, anticorps zgc:77119, anticorps tacstd1, anticorps MGC80540, anticorps EPCAM, anticorps egp, anticorps ksa, anticorps m4s1, anticorps mk-1, anticorps cd326, anticorps egp40, anticorps mic18, anticorps trop1, anticorps ep-cam, anticorps hegp-2, anticorps co17-1a, anticorps ga733-2, anticorps CD326, anticorps Egp314, anticorps EpCAM1, anticorps GA733-2, anticorps Ly74, anticorps Tacsd1, anticorps Tacstd1, anticorps gp40, anticorps epithelial cell adhesion molecule, anticorps flotillin 2, anticorps epithelial cell adhesion molecule S homeolog, anticorps EPCAM, anticorps FLOT2, anticorps epcam, anticorps epcam.S, anticorps Epcam

Sujet: Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell-cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Synonyms: AUA1 | CD326 | CD326 antigen | CO 17A | CO17 1A | CO17A | DIAR5 | EGP 2 | EGP | EGP2 | EGP314 | EGP40 | Ep CAM | EpCAM |Ep-CAM | Epithelial glycoprotein | ESA | GA733 1 | GA733 2 | GA733-2 | KS1/4 | M1S 1 | M1S2 | M4S1 | MIC18 | MK 1 | TACD1 | TACSTD1 | TROP1 | P16422

ID gène: 4072

UniProt: P16422