HNRNPH1 anticorps (N-Term)
-
- Antigène Voir toutes HNRNPH1 Anticorps
- HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))
-
Épitope
- AA 23-52, N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNRNPH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Fonction
- Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) detection. Tested with WB in Human.
- Séquence
- SADEVQRFFS DCKIQNGAQG IRFIYTREGR
- Réactivité croisée (Details)
- No cross reactivity with other proteins.
- Attributs du produit
-
Rabbit IgG polyclonal antibody for Heterogeneous nuclear ribonucleoprotein H (HNRNPH1) detection. Tested with WB in Human.
Gene Name: heterogeneous nuclear ribonucleoprotein H1 (H)
Protein Name: Heterogeneous nuclear ribonucleoprotein H - Purification
- Immunogen affinity purified.
- Immunogène
- A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP H (23-52aa SADEVQRFFSDCKIQNGAQGIRFIYTREGR), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product HNRNPH1 Anticorps primaire
-
-
- Indications d'application
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Commentaires
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Agent conservateur
- Sodium azide
- Précaution d'utilisation
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Conseil sur la manipulation
- Avoid repeated freezing and thawing.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Antigène
- HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))
- Autre désignation
- HNRNPH1 (HNRNPH1 Produits)
- Synonymes
- anticorps HNRPH, anticorps HNRPH1, anticorps hnRNPH, anticorps HNRNPH1, anticorps hnrph, anticorps hnrnph, anticorps hnrph1, anticorps hnrnph2, anticorps MGC78776, anticorps hnrph2, anticorps MGC80081, anticorps MGC130700, anticorps MGC69543, anticorps AI642080, anticorps E430005G16Rik, anticorps Hnrnph, anticorps Hnrph1, anticorps Hnrph, anticorps zgc:77712, anticorps heterogeneous nuclear ribonucleoprotein H1, anticorps heterogeneous nuclear ribonucleoprotein H2, anticorps heterogeneous nuclear ribonucleoprotein H1 S homeolog, anticorps heterogeneous nuclear ribonucleoprotein H1 L homeolog, anticorps HNRNPH1, anticorps HNRNPH2, anticorps hnrnph1.S, anticorps hnrnph1.L, anticorps hnrnph1, anticorps Hnrnph1
- Sujet
-
Heterogeneous nuclear ribonucleoprotein H is a protein that in humans is encoded by the HNRNPH1 gene. This gene encodes a member of a subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA. These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some may shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that bind to RNA and is very similar to the family member HNRPF. This gene may be associated with hereditary lymphedema type I. Alternatively spliced transcript variants have been described.
Synonyms: hnRNP H | hnRNPH | Hnrnph1 | HNRPH 1 | HNRPH | HNRPH1 protein | P31943 - ID gène
- 3187
- UniProt
- P31943
-