KRIT1 anticorps (C-Term)

N° du produit ABIN4886652

Détail du produit anti-KRIT1 anticorps

Antigène: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Épitope: AA 703-736, C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KRIT1 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection. Tested with WB in Human,Mouse,Rat.

Séquence: ENKMSFIVHT KQAGLVVKLL MKLNGQLMPT ERNS

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Krev interaction trapped protein 1(KRIT1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: KRIT1, ankyrin repeat containing
Protein Name: Krev interaction trapped protein 1

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human KRIT1 (703-736aa ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS), different from the related mouse sequence by one amino acid.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur KRIT1

Antigène: KRIT1 (KRIT1, Ankyrin Repeat Containing (KRIT1))

Autre désignation: KRIT1 (KRIT1 Produits)

Synonymes: anticorps CAM, anticorps CCM1, anticorps 2010007K12Rik, anticorps A630036P20Rik, anticorps AA432855, anticorps AI450393, anticorps AI643869, anticorps BB155247, anticorps BB235701, anticorps Ccm1, anticorps RGD1305929, anticorps krit1, anticorps fb36f07, anticorps san, anticorps santa, anticorps wu:fb36f07, anticorps zgc:63585, anticorps KRIT1, ankyrin repeat containing, anticorps KRIT1, anticorps Krit1, anticorps krit1

Sujet: Krev interaction trapped protein 1(KRIT1) is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

Synonyms: CAM | CCM 1 | CCM1 | KRIT 1 | KRIT1 | O00522

ID gène: 889

UniProt: O00522

Pathways: Cell RedoxHomeostasis