GAL4 anticorps (C-Term)

N° du produit ABIN4886660

Détail du produit anti-GAL4 anticorps

Antigène: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Épitope: AA 283-320, C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAL4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.

Séquence: DRFKVYANGQ HLFDFAHRLS AFQRVDTLEI QGDVTLSY

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Galectin-4(LGALS4) detection. Tested with WB in Human.
Gene Name: lectin, galactoside binding soluble 4
Protein Name: Galectin-4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human GAL4 (283-320aa DRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSY), different from the related mouse and rat sequences by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur GAL4

Antigène: GAL4 (LGALS4) (Galectin 4 (LGALS4))

Autre désignation: LGALS4 (LGALS4 Produits)

Synonymes: anticorps LGALS4, anticorps gal4, anticorps l36lbp, anticorps MGC86186, anticorps galectin-4, anticorps xgalectin-VIa, anticorps gal-4, anticorps L36LBP, anticorps L-36, anticorps L36LBI, anticorps GAL4, anticorps galectin 4, anticorps lectin, galactoside-binding, soluble, 4 L homeolog, anticorps Galectin-4, anticorps lectin, galactose binding, soluble 4, anticorps LGALS4, anticorps lgals4.L, anticorps leg4, anticorps Lgals4

Sujet: Galectin-4 is a protein that in humans is encoded by the LGALS4 gene. This gene is mapped to chromosome 19q13.2 based on an alignment of the LGALS4 sequence. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins.

Synonyms: Antigen NY CO 27 | Antigen NY-CO-27 | Antigen NYCO27 | GAL 4 | Gal-4 | GAL4 | Galectin 4 | Galectin-4 | Galectin -4 | L36LBP | LGALS4 | P56470

ID gène: 3960

UniProt: P56470