MMP13 anticorps (N-Term)

N° du produit ABIN4886667

Détail du produit anti-MMP13 anticorps

Antigène: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Épitope: AA 109-154, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MMP13 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.

Séquence: RTLKWSKMNL TYRIVNYTPD MTHSEVEKAF KKAFKVWSDV TPLNFT

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection. Tested with WB in Human.
Gene Name: matrix metallopeptidase 13
Protein Name: Collagenase 3

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-MMP13 (ABIN4886667)

Ma, Lv, Yu, Zhang, Kong, Niu, Yi: "Protective effects of tumor necrosis factor-α blockade by adalimumab on articular cartilage and subchondral bone in a rat model of osteoarthritis." dans: Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas, Vol. 48, Issue 10, pp. 863-70, (2016) (PubMed).

Liu, Tian, Zhou, Wang, Gou, Zhang, Wang, Shen, Zhang, Zhang: "Protective effect of calcitonin on lumbar fusion-induced adjacent-segment disc degeneration in ovariectomized rat." dans: BMC musculoskeletal disorders, Vol. 16, pp. 342, (2016) (PubMed).

Xia, He, Guo, Qing, He: "Effects of ultrasound on estradiol level, bone mineral density, bone biomechanics and matrix metalloproteinase-13 expression in ovariectomized rabbits." dans: Experimental and therapeutic medicine, Vol. 10, Issue 4, pp. 1429-1436, (2015) (PubMed).

Huang, Zou, Shi, Zhang, Pen, Zhang, Gao, Wang: "The effect of electroacupuncture on the extracellular matrix synthesis and degradation in a rabbit model of disc degeneration." dans: Evidence-based complementary and alternative medicine : eCAM, Vol. 2014, pp. 731395, (2014) (PubMed).

Détails sur MMP13

Antigène: MMP13 (Matrix Metallopeptidase 13 (Collagenase 3) (MMP13))

Autre désignation: MMP13 (MMP13 Produits)

Synonymes: anticorps CLG3, anticorps MANDP1, anticorps Clg, anticorps MMP-13, anticorps Mmp1, anticorps cb1034, anticorps mmp13, anticorps gene A, anticorps xCol, anticorps xcl3, anticorps MMP13, anticorps MGC108008, anticorps matrix metallopeptidase 13, anticorps matrix metallopeptidase 13a, anticorps matrix metallopeptidase 13 (collagenase 3) like S homeolog, anticorps matrix metallopeptidase 13 (collagenase 3), anticorps matrix metalloproteinase 13, anticorps matrix metallopeptidase 13 (collagenase 3) like L homeolog, anticorps MMP13, anticorps Mmp13, anticorps mmp13a, anticorps mmp13l.S, anticorps mmp13, anticorps LOC100136348, anticorps mmp13l.L

Sujet: Collagenase 3 is an enzyme that in humans is encoded by the MMP13 gene. This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.

Synonyms: CLG 3 | CLG3 | Collagenase 3 | Collagenase3 | MANDP1 | MDST | MMP13 | MMP-13 | MMP 13 | P45452

ID gène: 4322

UniProt: P45452