PVRL4 anticorps (N-Term)

N° du produit ABIN4886678

Détail du produit anti-PVRL4 anticorps

Antigène: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Épitope: AA 53-94, N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PVRL4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.

Séquence: FYRGDSGEQV GQVAWARVDA GEGAQELALL HSKYGL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Nectin-4(NECTIN4) detection. Tested with WB in Human.
Gene Name: nectin cell adhesion molecule 4
Protein Name: Nectin-4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PVRL4

Antigène: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Autre désignation: NECTIN4 (PVRL4 Produits)

Synonymes: anticorps PVRL4, anticorps si:ch211-155e24.1, anticorps 1200017F15Rik, anticorps Prr4, anticorps RGD1559826, anticorps EDSS1, anticorps LNIR, anticorps PRR4, anticorps nectin-4, anticorps nectin cell adhesion molecule 4, anticorps NECTIN4, anticorps nectin4, anticorps Nectin4

Sujet: PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

Synonyms: EDSS1 | Nectin 4 | Nectin-4 | PRR4 | pvrl4 | Q96NY8

ID gène: 81607

Pathways: Cell-Cell Junction Organization