NFIA anticorps (Middle Region)

N° du produit ABIN4886680

Détail du produit anti-NFIA anticorps

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Épitope: AA 180-224, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NFIA est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Nuclear factor 1 A-type(NFIA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: AYFVHAADSS QSESPSQPSD ADIKDQPENG HLGFQDSFVT SG

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Nuclear factor 1 A-type(NFIA) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: nuclear factor I A
Protein Name: Nuclear factor 1 A-type

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human NFIA (180-224aa AYFVHAADSSQSESPSQPSDADIKDQPENGHLGFQDSFVTSG VFS), different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur NFIA

Antigène: NFIA (Nuclear Factor I/A (NFIA))

Autre désignation: NFIA (NFIA Produits)

Synonymes: anticorps NFIA, anticorps CTF, anticorps NF-I/A, anticorps NF1-A, anticorps NFI-A, anticorps NFI-L, anticorps si:ch211-88d2.2, anticorps wu:fq27e07, anticorps zgc:158351, anticorps CNFI-A, anticorps cNFI-A3, anticorps 1110047K16Rik, anticorps 9430022M17Rik, anticorps NF1A, anticorps nuclear factor I A, anticorps nuclear factor I/A, anticorps NFIA, anticorps nfia, anticorps Nfia

Sujet: Nuclear factor 1 A-type is a protein that in humans is encoded by the NFIA gene. Nuclear factor I (NFI) proteins constitute a family of dimericDNA-binding proteins with similar, and possibly identical, DNA-binding specificity. They function as cellular transcription factors and as replication factors for adenovirus DNA replication. Diversity in this protein family is generated by multiple genes, differential splicing, and heterodimerization.

Synonyms: CTF | NF I/A | NF-I/A | NF1-A | NFI A | NFI L | NFI-A | NFIA | Q12857

ID gène: 4774

UniProt: Q12857