PSMA4 anticorps (Middle Region)

N° du produit ABIN4886707

Détail du produit anti-PSMA4 anticorps

Antigène: PSMA4 (Proteasome Subunit alpha 4 (PSMA4))

Épitope: AA 84-123, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PSMA4 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.

Séquence: NVLTNELRLI AQRYLLQYQE PIPCEQLVTA LCDIKQAYTQ

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Proteasome subunit alpha type-4(PSMA4) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: proteasome subunit alpha 4
Protein Name: Proteasome subunit alpha type-4

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human PSMA4 (84-123aa NVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQ), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur PSMA4

Antigène: PSMA4 (Proteasome Subunit alpha 4 (PSMA4))

Autre désignation: PSMA4 (PSMA4 Produits)

Synonymes: anticorps wu:fe05d10, anticorps zgc:56176, anticorps DDBDRAFT_0204055, anticorps DDBDRAFT_0214953, anticorps DDB_0204055, anticorps DDB_0214953, anticorps C9, anticorps HC9, anticorps HsT17706, anticorps PSC9, anticorps proteasome subunit alpha 4, anticorps proteasome subunit alpha 4 S homeolog, anticorps proteasome subunit alpha type 4, anticorps 20S proteasome subunit alpha-4, anticorps proteasome (prosome, macropain) subunit, alpha type 4, anticorps psma4, anticorps psma4.S, anticorps PSMA4, anticorps CNF01860, anticorps psmA4, anticorps Psma4

Sujet: Proteasome subunit alpha type-4, also known as macropain subunit C9, proteasome component C9, and 20S proteasome subunit alpha-3, is a protein that in humans is encoded by the PSMA4 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Synonyms: HC9 | Macropain subunit C9 | PSC9 | PSMA 4 | psmA4 | P25789

ID gène: 5685

UniProt: P25789

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA