SCTR anticorps (C-Term)

N° du produit ABIN4886718

Détail du produit anti-SCTR anticorps

Antigène: SCTR (Secretin Receptor (SCTR))

Épitope: AA 398-440, C-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCTR est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection. Tested with WB in Human,Rat.

Séquence: EVQKKWQQWH LREFPLHPVA SFSNSTKASH LEQSQGTCRT SII

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Secretin receptor(SCTR) detection. Tested with WB in Human,Rat.
Gene Name: secretin receptor
Protein Name: Secretin receptor

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence at the C-terminus of human SCTR (398-440aa EVQKKWQQWHLREFPLHPVASFSNSTKASHLEQSQGTCRTSII).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur SCTR

Antigène: SCTR (Secretin Receptor (SCTR))

Autre désignation: SCTR (SCTR Produits)

Synonymes: anticorps SR, anticorps 6530402O03Rik, anticorps SEC-R, anticorps secretin receptor, anticorps SCTR, anticorps Sctr

Sujet: Human secretin receptor (gene name SCTR) is a G protein-coupled receptor and belongs to the glucagon-VIP-secretin receptor family. It binds secretin which is the most potent regulator of pancreatic bicarbonate, electrolyte and volume secretion. Secretin and its receptor are suggested to be involved in pancreatic cancer and autism. The SCTR gene is mapped to chromosome 2q14.1 by fluorescence in situ hybridization.

Synonyms: SCT-R | SCTR | Secretin receptor | SR | P47872

ID gène: 6344

UniProt: P47872