ST7 anticorps (Middle Region)

N° du produit ABIN4886732

Détail du produit anti-ST7 anticorps

Antigène: ST7 (Suppression of Tumorigenicity 7 (ST7))

Épitope: AA 268-309, Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST7 est non-conjugé

Application: Western Blotting (WB)

Fonction: Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.

Séquence: DGCYRRSQQL QHHGSQYEAQ HRRDTNVLVY IKRRLAMCAR RL

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Suppressor of tumorigenicity 7 protein(ST7) detection. Tested with WB in Human.
Gene Name: suppression of tumorigenicity 7
Protein Name: Suppressor of tumorigenicity 7 protein

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human ST7 (268-309aa DGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKRRLAMCARRL), identical to the related mouse and rat sequences.

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Détails sur ST7

Antigène: ST7 (Suppression of Tumorigenicity 7 (ST7))

Autre désignation: ST7 (ST7 Produits)

Synonymes: anticorps ETS7q, anticorps FAM4A, anticorps FAM4A1, anticorps HELG, anticorps RAY1, anticorps SEN4, anticorps TSG7, anticorps 9430001H04Rik, anticorps Fam4a2, anticorps suppression of tumorigenicity 7, anticorps ST7, anticorps St7

Sujet: Suppressor of tumorigenicity protein 7 is a protein that in humans is encoded by the ST7 gene. The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutations for this gene are unlikely to be involved in the etiology of autism. The function of this gene product has not been determined. Transcript variants encoding different isoforms of this protein have been described.

Synonyms: ETS7q | FAM4A | FAM4A1 | HELG | RAY1 | SEN4 | ST7 | TSG7 | Q9NRC1

ID gène: 7982