TLN2 anticorps (Middle Region)

N° du produit ABIN4886745

Détail du produit anti-TLN2 anticorps

Antigène: TLN2 (Talin 2 (TLN2))

Épitope: AA 1787-1822, Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TLN2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Fonction: Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.

Séquence: NPKAQHTHDA ITEAAQLMKE AVDDIMVTLN EAASEV

Réactivité croisée (Details): No cross reactivity with other proteins.

Attributs du produit: Rabbit IgG polyclonal antibody for Talin-2(TLN2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: talin 2
Protein Name: Talin-2

Purification: Immunogen affinity purified.

Immunogène: A synthetic peptide corresponding to a sequence in the middle region of human Talin 2 (1787-1822aa NPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAASEV).

Isotype: IgG

Information d'application

Indications d'application: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Commentaires:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Agent conservateur: Sodium azide

Précaution d'utilisation: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Conseil sur la manipulation: Avoid repeated freezing and thawing.

Stock: 4 °C/-20 °C

Stockage commentaire: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Références pour anticorps anti-TLN2 (ABIN4886745)

Li, Li, Qi, Rychahou, Jafari, Huang: "The role of talin2 in breast cancer tumorigenesis and metastasis." dans: Oncotarget, Vol. 8, Issue 63, pp. 106876-106887, (2017) (PubMed).

Détails sur TLN2

Antigène: TLN2 (Talin 2 (TLN2))

Autre désignation: TLN2 (TLN2 Produits)

Synonymes: anticorps TLN2, anticorps ilweq, anticorps talin-2, anticorps ILWEQ, anticorps 5730421P04Rik, anticorps AI507121, anticorps AI787438, anticorps AL118320, anticorps mKIAA0320, anticorps RGD1565416, anticorps talin 2, anticorps talin 2 S homeolog, anticorps TLN2, anticorps tln2.S, anticorps tln2, anticorps Tln2

Sujet: Talin 2 is a protein in humans that is encoded by the TLN2 gene. It belongs to the talin protein family. This gene encodes a protein related to talin 1, a cytoskeletal protein that plays a significant role in the assembly of actin filaments and in spreading and migration of various cell types, including fibroblasts and osteoclasts. Talin-2 is expressed at high levels in cardiac muscle and functions to provide linkages between the extracellular matrix and actin cytoskeleton at costamere structures to transduce force laterally.

Synonyms: Talin2 | Talin 2 | Talin-2 | TLN2 | TLN 2 | TLN-2 | ILWEQ | Q9Y4G6

ID gène: 83660

UniProt: Q9Y4G6

Pathways: Cell-Cell Junction Organization, Maintenance of Protein Location